"TMEM39A" Related Products

Expand

Recombinant Human TMEM39A Protein, His-tagged

Cat.No.: TMEM39A-3289H
Product Overview: Recombinant Human TMEM39A(191-297aa) fused with His tag was produced in E. coli.
Source: E. coli
Species: Human
Tag : His
Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol.
Protein length: 191-297aa
AA sequence: YPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAY
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: TMEM39A transmembrane protein 39A [ Homo sapiens ]
Official Symbol: TMEM39A
Synonyms: TMEM39A; transmembrane protein 39A; FLJ10902;
Gene ID: 55254
mRNA Refseq: NM_018266
Protein Refseq: NP_060736
UniProt ID: Q9NV64

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.