Recombinant Human TMEM39A Protein, His-tagged
| Cat.No. : | TMEM39A-3289H |
| Product Overview : | Recombinant Human TMEM39A(191-297aa) fused with His tag was produced in E. coli. |
| Availability | November 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 191-297aa |
| Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol. |
| AA sequence : | YPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAY |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | TMEM39A transmembrane protein 39A [ Homo sapiens ] |
| Official Symbol | TMEM39A |
| Synonyms | TMEM39A; transmembrane protein 39A; FLJ10902; |
| Gene ID | 55254 |
| mRNA Refseq | NM_018266 |
| Protein Refseq | NP_060736 |
| UniProt ID | Q9NV64 |
| ◆ Recombinant Proteins | ||
| TMEM39A-6167R | Recombinant Rat TMEM39A Protein | +Inquiry |
| TMEM39A-3289H | Recombinant Human TMEM39A Protein, His-tagged | +Inquiry |
| TMEM39A-10033Z | Recombinant Zebrafish TMEM39A | +Inquiry |
| TMEM39A-17039M | Recombinant Mouse TMEM39A Protein | +Inquiry |
| TMEM39A-4823R | Recombinant Rhesus monkey TMEM39A Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM39A Products
Required fields are marked with *
My Review for All TMEM39A Products
Required fields are marked with *
Recently Viewed
