Recombinant Human TMEM39A Protein, His-tagged
Cat.No. : | TMEM39A-3289H |
Product Overview : | Recombinant Human TMEM39A(191-297aa) fused with His tag was produced in E. coli. |
Availability | October 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-297aa |
Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.) added with 300mM Imidazole and 15% glycerol. |
AA sequence : | YPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAY |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | TMEM39A transmembrane protein 39A [ Homo sapiens ] |
Official Symbol | TMEM39A |
Synonyms | TMEM39A; transmembrane protein 39A; FLJ10902; |
Gene ID | 55254 |
mRNA Refseq | NM_018266 |
Protein Refseq | NP_060736 |
UniProt ID | Q9NV64 |
◆ Recombinant Proteins | ||
TMEM39A-10033Z | Recombinant Zebrafish TMEM39A | +Inquiry |
TMEM39A-4637R | Recombinant Rhesus Macaque TMEM39A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM39A-4823R | Recombinant Rhesus monkey TMEM39A Protein, His-tagged | +Inquiry |
TMEM39A-6167R | Recombinant Rat TMEM39A Protein | +Inquiry |
TMEM39A-3288H | Recombinant Human TMEM39A, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM39A Products
Required fields are marked with *
My Review for All TMEM39A Products
Required fields are marked with *