Recombinant Human TMIGD2 Protein, Fc-tagged
Cat.No. : | TMIGD2-135H |
Product Overview : | Recombinant human TMIGD2 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 282 |
Description : | Enables coreceptor activity. Involved in positive regulation of T cell activation; positive regulation of angiogenesis; and positive regulation of cytokine production. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in extracellular space. |
Form : | Lyophilized |
Molecular Mass : | 40.6 kDa |
AA Sequence : | MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TMIGD2 transmembrane and immunoglobulin domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | TMIGD2 |
Synonyms | IGPR1; IGPR-1 |
Gene ID | 126259 |
mRNA Refseq | NM_144615 |
Protein Refseq | NP_653216 |
MIM | 614715 |
UniProt ID | Q96BF3 |
◆ Recombinant Proteins | ||
TMIGD2-567H | Active Recombinant Human TMIGD2, Fc-tagged, Biotinylated | +Inquiry |
TMIGD2-122H | Recombinant Human TMIGD2 Protein, His-tagged | +Inquiry |
TMIGD2-2837H | Recombinant Human TMIGD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMIGD2-6719H | Recombinant Human TMIGD2 Protein (Leu23-Gly150), C-His tagged | +Inquiry |
TMIGD2-1146H | Active Recombinant Human TMIGD2 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMIGD2-919HCL | Recombinant Human TMIGD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMIGD2 Products
Required fields are marked with *
My Review for All TMIGD2 Products
Required fields are marked with *
0
Inquiry Basket