Recombinant Human TMIGD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TMIGD2-2837H |
| Product Overview : | TMIGD2 MS Standard C13 and N15-labeled recombinant protein (NP_653216) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Plays a role in cell-cell interaction, cell migration, and angiogenesis. Through interaction with HHLA2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade. |
| Molecular Mass : | 30.7 kDa |
| AA Sequence : | MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TMIGD2 transmembrane and immunoglobulin domain containing 2 [ Homo sapiens (human) ] |
| Official Symbol | TMIGD2 |
| Synonyms | TMIGD2; transmembrane and immunoglobulin domain containing 2; CD28H; IGPR1; IGPR-1; transmembrane and immunoglobulin domain-containing protein 2; CD28 homolog; CD28 homologue; immunoglobulin and proline-rich receptor 1; immunoglobulin-containing and proline-rich receptor 1; transmembrane and immunoglobulin domain-containing protein 2 variant 2; transmembrane and immunoglobulin domain-containing protein 2 variant 3 |
| Gene ID | 126259 |
| mRNA Refseq | NM_144615 |
| Protein Refseq | NP_653216 |
| MIM | 614715 |
| UniProt ID | Q96BF3 |
| ◆ Recombinant Proteins | ||
| TMIGD2-567H | Active Recombinant Human TMIGD2, Fc-tagged, Biotinylated | +Inquiry |
| TMIGD2-6719H | Recombinant Human TMIGD2 Protein (Leu23-Gly150), C-His tagged | +Inquiry |
| TMIGD2-579H | Recombinant Human TMIGD2 Protein, His-tagged | +Inquiry |
| TMIGD2-135H | Recombinant Human TMIGD2 Protein, Fc-tagged | +Inquiry |
| TMIGD2-568H | Recombinant Human TMIGD2 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMIGD2-919HCL | Recombinant Human TMIGD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMIGD2 Products
Required fields are marked with *
My Review for All TMIGD2 Products
Required fields are marked with *
