Recombinant Human TMOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMOD2-6416H |
Product Overview : | TMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_055363) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMOD2 tropomodulin 2 [ Homo sapiens (human) ] |
Official Symbol | TMOD2 |
Synonyms | TMOD2; tropomodulin 2 (neuronal); tropomodulin-2; NTMOD; neuronal tropomodulin; N-TMOD; MGC39481; |
Gene ID | 29767 |
mRNA Refseq | NM_014548 |
Protein Refseq | NP_055363 |
MIM | 602928 |
UniProt ID | Q9NZR1 |
◆ Recombinant Proteins | ||
TMOD2-6416H | Recombinant Human TMOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMOD2-778C | Recombinant Cynomolgus Monkey TMOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMOD2-1035C | Recombinant Cynomolgus TMOD2 Protein, His-tagged | +Inquiry |
TMOD2-4851R | Recombinant Rhesus monkey TMOD2 Protein, His-tagged | +Inquiry |
Tmod2-5189R | Recombinant Rat Tmod2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMOD2-916HCL | Recombinant Human TMOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMOD2 Products
Required fields are marked with *
My Review for All TMOD2 Products
Required fields are marked with *