Recombinant Human TMPRSS2 protein, His-SUMO-tagged
| Cat.No. : | TMPRSS2-4593H |
| Product Overview : | Recombinant Human TMPRSS2 protein(O15393)(106-492aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 106-492aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| AA Sequence : | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ] |
| Official Symbol | TMPRSS2 |
| Synonyms | TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; epitheliasin; serine protease 10; PP9284; FLJ41954; |
| Gene ID | 7113 |
| mRNA Refseq | NM_001135099 |
| Protein Refseq | NP_001128571 |
| MIM | 602060 |
| UniProt ID | O15393 |
| ◆ Recombinant Proteins | ||
| TMPRSS2-123H | Recombinant Human TMPRSS2 Protein | +Inquiry |
| TMPRSS2-1912Z | Recombinant Zebrafish TMPRSS2 | +Inquiry |
| Tmprss2-429R | Recombinant Rat Tmprss2 Protein, His-tagged | +Inquiry |
| TMPRSS2-4592H | Recombinant Human TMPRSS2 protein, MBP&His-Avi-tagged | +Inquiry |
| TMPRSS2-01H | Recombinant Human TMPRSS2 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMPRSS2-910HCL | Recombinant Human TMPRSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS2 Products
Required fields are marked with *
My Review for All TMPRSS2 Products
Required fields are marked with *



