Recombinant Human TMPRSS2 protein

Cat.No. : TMPRSS2-01H
Product Overview : Recombinant Human TMPRSS2 protein was expressed in E.coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : 25mM Tris, pH 9.0, 250mM NaCl.
Molecular Mass : The protein has a calculated MW of 26.1 kDa.
AA Sequence : MIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMR
Purity : >90% by SDS-PAGE.
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.22 mg/ml
Gene Name TMPRSS2
Official Symbol TMPRSS2
Synonyms PRSS10
Gene ID 7113
mRNA Refseq NM_001135099.1
Protein Refseq NP_001128571.1
MIM 602060
UniProt ID O15393

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMPRSS2 Products

Required fields are marked with *

My Review for All TMPRSS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon