Recombinant Human TMPRSS4 protein, His&Myc-tagged
| Cat.No. : | TMPRSS4-674H |
| Product Overview : | Recombinant Human TMPRSS4 protein(Q9NRS4)(54-437aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 54-437a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 49.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL |
| Gene Name | TMPRSS4 transmembrane protease, serine 4 [ Homo sapiens ] |
| Official Symbol | TMPRSS4 |
| Synonyms | TMPRSS4; transmembrane protease, serine 4; transmembrane protease serine 4; membrane type serine protease 2; MT SP2; TMPRSS3; transmembrane serine protease 3; type II membrane serine protease; channel-activating protease 2; membrane-type serine protease 2; CAPH2; MT-SP2; |
| Gene ID | 56649 |
| mRNA Refseq | NM_001083947 |
| Protein Refseq | NP_001077416 |
| MIM | 606565 |
| UniProt ID | Q9NRS4 |
| ◆ Recombinant Proteins | ||
| Tmprss4-6527M | Recombinant Mouse Tmprss4 Protein, Myc/DDK-tagged | +Inquiry |
| TMPRSS4-5995HFL | Recombinant Full Length Human TMPRSS4, Flag-tagged | +Inquiry |
| TMPRSS4-9456M | Recombinant Mouse TMPRSS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMPRSS4-458C | Active Recombinant Cynomolgus TMPRSS4 protein, His-Avi-tagged | +Inquiry |
| TMPRSS4-17121M | Recombinant Mouse TMPRSS4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMPRSS4-908HCL | Recombinant Human TMPRSS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMPRSS4 Products
Required fields are marked with *
My Review for All TMPRSS4 Products
Required fields are marked with *
