| Description : |
Thymosin Beta 4 is a naturally occurring peptide. It is found in high concentrations in blood platelets, wound fluid and other tissues in the body. Tβ4 is not a growth factor; rather, it is a major actin regulating peptide. The thymosin beta-4 peptide, if used after a heart attack, might reactivate cardiac progenitor cells to repair damaged heart tissue. |
| Source : |
E. coli |
| Species : |
Human |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Data is not available. |
| Molecular Mass : |
Approximately 4.9 kDa, a single non-glycosylated polypeptide chain containing 43 amino acids. |
| Protein Length : |
43 |
| AA Sequence : |
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Endotoxin : |
Less than 1 EU/mg of rHuTβ4 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
