Recombinant Human TNC
Cat.No. : | TNC-31215TH |
Product Overview : | Recombinant fragment corresponding to amino acids 181-290 of Human Tenascin C with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLA CPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEH GTCVDGLCVCHDGFAGDDCNKPLCLNNCYN |
Sequence Similarities : | Belongs to the tenascin family.Contains 15 EGF-like domains.Contains 1 fibrinogen C-terminal domain.Contains 15 fibronectin type-III domains. |
Gene Name | TNC tenascin C [ Homo sapiens ] |
Official Symbol | TNC |
Synonyms | TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN; |
Gene ID | 3371 |
mRNA Refseq | NM_002160 |
Protein Refseq | NP_002151 |
MIM | 187380 |
Uniprot ID | P24821 |
Chromosome Location | 9q32-q34 |
Pathway | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | binding; receptor binding; syndecan binding; |
◆ Recombinant Proteins | ||
TNC-735H | Recombinant Human TNC protein(Gly23-Ser621), His-tagged | +Inquiry |
TNC-995HFL | Recombinant Full Length Human TNC Protein, C-Flag-tagged | +Inquiry |
TNC-734H | Active Recombinant Human TNC, His-tagged | +Inquiry |
TNC-2566M | Recombinant Mouse TNC Protein (1884-2099 aa), His-tagged | +Inquiry |
Tnc-736M | Recombinant Mouse Tnc protein(Gly23-Ser621), His-tagged | +Inquiry |
◆ Native Proteins | ||
TNC-08H | Native Human TNC Protein | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNC Products
Required fields are marked with *
My Review for All TNC Products
Required fields are marked with *