Recombinant Human TNC

Cat.No. : TNC-31215TH
Product Overview : Recombinant fragment corresponding to amino acids 181-290 of Human Tenascin C with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLA CPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEH GTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
Sequence Similarities : Belongs to the tenascin family.Contains 15 EGF-like domains.Contains 1 fibrinogen C-terminal domain.Contains 15 fibronectin type-III domains.
Gene Name TNC tenascin C [ Homo sapiens ]
Official Symbol TNC
Synonyms TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN;
Gene ID 3371
mRNA Refseq NM_002160
Protein Refseq NP_002151
MIM 187380
Uniprot ID P24821
Chromosome Location 9q32-q34
Pathway ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function binding; receptor binding; syndecan binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNC Products

Required fields are marked with *

My Review for All TNC Products

Required fields are marked with *

0
cart-icon
0
compare icon