Recombinant Human TNC protein, GST-tagged
Cat.No. : | TNC-301211H |
Product Overview : | Recombinant Human TNC (23-200 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly23-Cys200 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TNC tenascin C [ Homo sapiens ] |
Official Symbol | TNC |
Synonyms | TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN; GP 150-225; cytotactin; neuronectin; myotendinous antigen; tenascin-C isoform 14/AD1/16; glioma-associated-extracellular matrix antigen; GP; JI; HXB; GMEM; TN-C; 150-225; |
Gene ID | 3371 |
mRNA Refseq | NM_002160 |
Protein Refseq | NP_002151 |
MIM | 187380 |
UniProt ID | P24821 |
◆ Recombinant Proteins | ||
TNC-2566M | Recombinant Mouse TNC Protein (1884-2099 aa), His-tagged | +Inquiry |
TNC-4224H | Recombinant Human TNC Protein, His (Fc)-Avi-tagged | +Inquiry |
TNC-256R | Recombinant Rabbit Cardiac Troponin C | +Inquiry |
TNC-34H | Recombinant Human TNC protein, His-tagged | +Inquiry |
TNC-311H | Recombinant Human Transthyretin (Wild Type) Protein, 13C, 15N Label | +Inquiry |
◆ Native Proteins | ||
TNC-08H | Native Human TNC Protein | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNC Products
Required fields are marked with *
My Review for All TNC Products
Required fields are marked with *
0
Inquiry Basket