Recombinant Human TNC protein, GST-tagged

Cat.No. : TNC-301211H
Product Overview : Recombinant Human TNC (23-200 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gly23-Cys200
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TNC tenascin C [ Homo sapiens ]
Official Symbol TNC
Synonyms TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN; GP 150-225; cytotactin; neuronectin; myotendinous antigen; tenascin-C isoform 14/AD1/16; glioma-associated-extracellular matrix antigen; GP; JI; HXB; GMEM; TN-C; 150-225;
Gene ID 3371
mRNA Refseq NM_002160
Protein Refseq NP_002151
MIM 187380
UniProt ID P24821

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNC Products

Required fields are marked with *

My Review for All TNC Products

Required fields are marked with *

0
cart-icon