Recombinant Human TNF Protein
Cat.No. : | TNF-62H |
Product Overview : | Recombinant Human TNF Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. |
Form : | Liquid. In 100 mM Tris-HCl pH8.0, 100 mM NaH2PO4. |
Molecular Mass : | ~55.6 kDa |
AA Sequence : | MTHHHHHHAGGAENLYFQGSACDCRGDCFCGGGSVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.05 mg/ml |
Official Full Name : | Tumor necrosis factor |
Gene Name | TNF tumor necrosis factor [ Homo sapiens (human) ] |
Official Symbol | TNF |
Synonyms | DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha |
Gene ID | 7124 |
mRNA Refseq | NM_000594 |
Protein Refseq | NP_000585 |
MIM | 191160 |
UniProt ID | P01375 |
◆ Recombinant Proteins | ||
TNF-35H | Recombinant Human TNF protein, His-tagged | +Inquiry |
TNF-309P | Recombinant Porcine Tumor Necrosis Factor | +Inquiry |
TNF-3596B | Recombinant Bovine TNF protein, His-tagged | +Inquiry |
Tnf-236M | Recombinant Mouse Tnf protein, His/S-tagged | +Inquiry |
TNF-380H | Recombinant Horse Tumor Necrosis Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
0
Inquiry Basket