Recombinant Human TNF Protein

Cat.No. : TNF-79H
Product Overview : TNF-alpha was produced in E. coli cells transformed with human TNF-alpha gene. This product is sterile and does not contain any components of animal origin.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
AA Sequence : GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity : > 95% by SDS-PAGE
Quality Control Test : Verified by Mass Spectrometry analysis.
Storage : Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade.
Concentration : 0.5 mg/mL
Storage Buffer : Sterile filtered through a 0.2 micron filter in 50% glycerol, 10 mM Tris buffer at pH 8, 50 mM NaCl
Gene Name TNF tumor necrosis factor [ Homo sapiens (human) ]
Official Symbol TNF
Synonyms TNF; tumor necrosis factor; DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha; tumor necrosis factor; APC1 protein; TNF, macrophage-derived; TNF, monocyte-derived; TNF-a; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor-alpha; tumor necrotic factor alpha
Gene ID 7124
mRNA Refseq NM_000594
Protein Refseq NP_000585
MIM 191160
UniProt ID P01375

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNF Products

Required fields are marked with *

My Review for All TNF Products

Required fields are marked with *

0
cart-icon