Recombinant Human TNFAIP8 protein, GST-tagged
| Cat.No. : | TNFAIP8-3620H |
| Product Overview : | Recombinant Human TNFAIP8 protein(1-198 aa), fused to GST tag, was expressed in E. coli. |
| Availability | August 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-198 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TNFAIP8 tumor necrosis factor, alpha-induced protein 8 [ Homo sapiens ] |
| Official Symbol | TNFAIP8 |
| Synonyms | TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13; |
| Gene ID | 25816 |
| mRNA Refseq | NM_001077654 |
| Protein Refseq | NP_001071122 |
| MIM | 612111 |
| UniProt ID | O95379 |
| ◆ Recombinant Proteins | ||
| TNFAIP8-535H | Recombinant Human TNFAIP8 protein, His-tagged | +Inquiry |
| TNFAIP8-4864R | Recombinant Rhesus monkey TNFAIP8 Protein, His-tagged | +Inquiry |
| TNFAIP8-3316H | Recombinant Human TNFAIP8 protein, His-tagged | +Inquiry |
| TNFAIP8-5277H | Recombinant Human TNFAIP8 protein, GST-tagged | +Inquiry |
| TNFAIP8-6568H | Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFAIP8-448HKCL | Human TNFAIP8 Knockdown Cell Lysate | +Inquiry |
| TNFAIP8-895HCL | Recombinant Human TNFAIP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP8 Products
Required fields are marked with *
My Review for All TNFAIP8 Products
Required fields are marked with *



