Recombinant Human TNFAIP8 protein, GST-tagged
Cat.No. : | TNFAIP8-3620H |
Product Overview : | Recombinant Human TNFAIP8 protein(1-198 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-198 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TNFAIP8 tumor necrosis factor, alpha-induced protein 8 [ Homo sapiens ] |
Official Symbol | TNFAIP8 |
Synonyms | TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13; |
Gene ID | 25816 |
mRNA Refseq | NM_001077654 |
Protein Refseq | NP_001071122 |
MIM | 612111 |
UniProt ID | O95379 |
◆ Recombinant Proteins | ||
TNFAIP8-3316H | Recombinant Human TNFAIP8 protein, His-tagged | +Inquiry |
TNFAIP8-3089C | Recombinant Chicken TNFAIP8 | +Inquiry |
TNFAIP8-5277H | Recombinant Human TNFAIP8 protein, GST-tagged | +Inquiry |
TNFAIP8-3620H | Recombinant Human TNFAIP8 protein, GST-tagged | +Inquiry |
TNFAIP8-3981H | Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFAIP8-895HCL | Recombinant Human TNFAIP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFAIP8 Products
Required fields are marked with *
My Review for All TNFAIP8 Products
Required fields are marked with *
0
Inquiry Basket