Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TNFAIP8-6568H |
Product Overview : | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. |
Molecular Mass : | 23 kDa |
AA Sequence : | MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TNFAIP8 TNF alpha induced protein 8 [ Homo sapiens (human) ] |
Official Symbol | TNFAIP8 |
Synonyms | TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13; |
Gene ID | 25816 |
mRNA Refseq | NM_014350 |
Protein Refseq | NP_055165 |
MIM | 612111 |
UniProt ID | O95379 |
◆ Recombinant Proteins | ||
TNFAIP8-3089C | Recombinant Chicken TNFAIP8 | +Inquiry |
Tnfaip8-312M | Recombinant Mouse Tnfaip8 Protein, MYC/DDK-tagged | +Inquiry |
TNFAIP8-535H | Recombinant Human TNFAIP8 protein, His-tagged | +Inquiry |
TNFAIP8-4864R | Recombinant Rhesus monkey TNFAIP8 Protein, His-tagged | +Inquiry |
TNFAIP8-5277H | Recombinant Human TNFAIP8 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFAIP8-895HCL | Recombinant Human TNFAIP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP8 Products
Required fields are marked with *
My Review for All TNFAIP8 Products
Required fields are marked with *
0
Inquiry Basket