Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TNFAIP8-3981H | 
| Product Overview : | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. | 
| Molecular Mass : | 21.7 kDa | 
| AA Sequence : | MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENITRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | TNFAIP8 TNF alpha induced protein 8 [ Homo sapiens (human) ] | 
| Official Symbol | TNFAIP8 | 
| Synonyms | TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13; | 
| Gene ID | 25816 | 
| mRNA Refseq | NM_001077654 | 
| Protein Refseq | NP_001071122 | 
| MIM | 612111 | 
| UniProt ID | O95379 | 
| ◆ Recombinant Proteins | ||
| TNFAIP8-5277H | Recombinant Human TNFAIP8 protein, GST-tagged | +Inquiry | 
| TNFAIP8-3089C | Recombinant Chicken TNFAIP8 | +Inquiry | 
| TNFAIP8-6568H | Recombinant Human TNFAIP8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| TNFAIP8-4864R | Recombinant Rhesus monkey TNFAIP8 Protein, His-tagged | +Inquiry | 
| TNFAIP8-4678R | Recombinant Rhesus Macaque TNFAIP8 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TNFAIP8-895HCL | Recombinant Human TNFAIP8 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP8 Products
Required fields are marked with *
My Review for All TNFAIP8 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            