Recombinant Human TNFRSF10C Protein, Fc/His-tagged
Cat.No. : | TNFRSF10C-308H |
Product Overview : | Recombinant Human TNFRSF10C fused with Fc/His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 48.7kD |
AA Sequence : | ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TNFRSF10C tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain [ Homo sapiens ] |
Official Symbol | TNFRSF10C |
Synonyms | TNFRSF10C; tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain; tumor necrosis factor receptor superfamily member 10C; CD263; DcR1; LIT; TRAILR3; TRID; decoy receptor 1; cytotoxic TRAIL receptor-3; lymphocyte inhibitor of TRAIL; decoy TRAIL receptor without death domain; antagonist decoy receptor for TRAIL/Apo-2L; TNF-related apoptosis-inducing ligand receptor 3; DCR1; TRAIL-R3; DCR1-TNFR; MGC149501; MGC149502; |
Gene ID | 8794 |
mRNA Refseq | NM_003841 |
Protein Refseq | NP_003832 |
MIM | 603613 |
UniProt ID | O14798 |
◆ Recombinant Proteins | ||
TNFRSF10C-307H | Recombinant Human TNFRSF10C Protein | +Inquiry |
TNFRSF10C-4494H | Recombinant Human TNFRSF10C Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF10C-7855H | Recombinant Human TNFRSF10C protein, His-tagged | +Inquiry |
TNFRSF10C-308H | Recombinant Human TNFRSF10C Protein, Fc/His-tagged | +Inquiry |
TNFRSF10C-68H | Recombinant Human TRAIL-R3, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10C-893HCL | Recombinant Human TNFRSF10C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF10C Products
Required fields are marked with *
My Review for All TNFRSF10C Products
Required fields are marked with *