Recombinant Human TNFRSF10D protein, His-tagged
Cat.No. : | TNFRSF10D-4533H |
Product Overview : | Recombinant Human TNFRSF10D protein(Q9UBN6)(56-211aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 56-211aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH |
Gene Name | TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain [ Homo sapiens ] |
Official Symbol | TNFRSF10D |
Synonyms | TNFRSF10D; tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain; tumor necrosis factor receptor superfamily member 10D; CD264; DcR2; TRAILR4; TRUNDD; TRAIL receptor 4; decoy receptor 2; decoy with truncated death domain; TNF receptor-related receptor for TRAIL; TRAIL receptor with a truncated death domain; TNF-related apoptosis-inducing ligand receptor 4; DCR2; TRAIL-R4; |
Gene ID | 8793 |
mRNA Refseq | NM_003840 |
Protein Refseq | NP_003831 |
MIM | 603614 |
UniProt ID | Q9UBN6 |
◆ Recombinant Proteins | ||
TNFRSF10D-1641R | Recombinant Rhesus Monkey TNFRSF10D Protein | +Inquiry |
TNFRSF10D-8826C | Recombinant Cynomolgus TNFRSF10D, His tagged | +Inquiry |
TNFRSF10D-69H | Recombinant Human TRAIL-R4, Fc-tagged | +Inquiry |
TNFRSF10D-464H | Recombinant Human TNFRSF10D Protein, His-tagged | +Inquiry |
TNFRSF10D-193H | Recombinant Human TNFRSF10D protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10D-2459HCL | Recombinant Human TNFRSF10D cell lysate | +Inquiry |
TNFRSF10D-1188CCL | Recombinant Cynomolgus TNFRSF10D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF10D Products
Required fields are marked with *
My Review for All TNFRSF10D Products
Required fields are marked with *
0
Inquiry Basket