Recombinant Human TNFRSF10D protein, His-tagged

• Cat.No.: TNFRSF10D-4533H
• Product Overview: Recombinant Human TNFRSF10D protein(Q9UBN6)(56-211aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 56-211aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

Gene Information

• Gene Name: TNFRSF10D tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain [ Homo sapiens ]
• Official Symbol: TNFRSF10D
• Synonyms: TNFRSF10D; tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain; tumor necrosis factor receptor superfamily member 10D; CD264; DcR2; TRAILR4; TRUNDD; TRAIL receptor 4; decoy receptor 2; decoy with truncated death domain; TNF receptor-related receptor for TRAIL; TRAIL receptor with a truncated death domain; TNF-related apoptosis-inducing ligand receptor 4; DCR2; TRAIL-R4
• Gene ID: 8793
• mRNA Refseq: NM_003840
• Protein Refseq: NP_003831
• MIM: 603614
• UniProt ID: Q9UBN6