Recombinant Human TNFRSF13B protein
Cat.No. : | TNFRSF13B-970H |
Product Overview : | Recombinant Human TNFRSF13B protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 160 |
Description : | The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity is determined by its ability to block human BAFF induced T2B cell survival using a concentration range of 1.0-3.0 µg/ml. |
Molecular Mass : | Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
AA Sequence : | MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV |
Endotoxin : | Less than 1 EU/μg of rHuTACI/TNFRSF13B as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF13B |
Official Symbol | TNFRSF13B |
Synonyms | TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214; |
Gene ID | 23495 |
mRNA Refseq | NM_012452 |
Protein Refseq | NP_036584 |
MIM | 604907 |
UniProt ID | O14836 |
◆ Recombinant Proteins | ||
TNFRSF13B-151H | Recombinant Human TNFRSF13B Protein, DYKDDDDK-tagged | +Inquiry |
TNFRSF13B-2095H | Recombinant Human TNFRSF13B, Fc-tagged | +Inquiry |
TNFRSF13B-7545H | Recombinant Human TNFRSF13B, His-tagged | +Inquiry |
Tnfrsf13b-6105M | Recombinant Mouse Tnfrsf13b Protein (Phe5-Thr129), C-Fc tagged | +Inquiry |
TNFRSF13B-693H | Active Recombinant Human TNFRSF13B, Fc-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13B-1916HCL | Recombinant Human TNFRSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF13B Products
Required fields are marked with *
My Review for All TNFRSF13B Products
Required fields are marked with *