Recombinant Human TNFRSF13B Protein, His-tagged

Cat.No. : TNFRSF13B-040H
Product Overview : Recombinant Human TNFRSF13B Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI), also known as tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) and cluster of differentiation 267 (CD267), is a single-pass type III membrane receptor that is highly expressed on the surface of mature innate-like B cells, such as marginal zone and B-1 B cells in mice, and memory B cells in humans. TACI/TNFRSF13B/CD267 is also expressed on the surface of activated T cells, while monocytes and dendritic cells express lower levels of TACI/TNFRSF13B/CD267 primarily intracellularly. TACI/TNFRSF13B/CD267 is the receptor for soluble ligands BAFF/TNFSF13B and APRIL/TNFSF13. Upon ligation, TACI/TNFRSF13B/CD267 recruits tumor necrosis factor receptor–associated factor (TRAF) family members and calcium signal-modulating cyclophilin ligand (CAMLG) in order to activate NFAT, NF-κB, and AP-1 transcriptional programs. TACI/TNFRSF13B/CD267 is necessary for T cell-independent type II and type I responses, negative regulation of B cell and T follicular helper cell numbers, and promotion of class switch recombination in B cells. Mutations and aberrant regulation of TACI/TNFRSF13B/CD267 has been associated with cancer, autoimmune diseases, and immunodeficiency disorders. Multiple isoforms produced by alternative splicing have been identified.
Molecular Mass : ~22 kDa
AA Sequence : MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name TNFRSF13B tumor necrosis factor receptor superfamily, member 13B [ Homo sapiens (human) ]
Official Symbol TNFRSF13B
Synonyms TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214;
Gene ID 23495
mRNA Refseq NM_012452
Protein Refseq NP_036584
MIM 604907
UniProt ID O14836

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF13B Products

Required fields are marked with *

My Review for All TNFRSF13B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon