Recombinant Human TNFRSF13B Protein, His-tagged
Cat.No. : | TNFRSF13B-040H |
Product Overview : | Recombinant Human TNFRSF13B Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI), also known as tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) and cluster of differentiation 267 (CD267), is a single-pass type III membrane receptor that is highly expressed on the surface of mature innate-like B cells, such as marginal zone and B-1 B cells in mice, and memory B cells in humans. TACI/TNFRSF13B/CD267 is also expressed on the surface of activated T cells, while monocytes and dendritic cells express lower levels of TACI/TNFRSF13B/CD267 primarily intracellularly. TACI/TNFRSF13B/CD267 is the receptor for soluble ligands BAFF/TNFSF13B and APRIL/TNFSF13. Upon ligation, TACI/TNFRSF13B/CD267 recruits tumor necrosis factor receptor–associated factor (TRAF) family members and calcium signal-modulating cyclophilin ligand (CAMLG) in order to activate NFAT, NF-κB, and AP-1 transcriptional programs. TACI/TNFRSF13B/CD267 is necessary for T cell-independent type II and type I responses, negative regulation of B cell and T follicular helper cell numbers, and promotion of class switch recombination in B cells. Mutations and aberrant regulation of TACI/TNFRSF13B/CD267 has been associated with cancer, autoimmune diseases, and immunodeficiency disorders. Multiple isoforms produced by alternative splicing have been identified. |
Molecular Mass : | ~22 kDa |
AA Sequence : | MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TNFRSF13B tumor necrosis factor receptor superfamily, member 13B [ Homo sapiens (human) ] |
Official Symbol | TNFRSF13B |
Synonyms | TNFRSF13B; tumor necrosis factor receptor superfamily, member 13B; tumor necrosis factor receptor superfamily member 13B; CD267; TACI; tumor necrosis factor receptor 13B; transmembrane activator and CAML interactor; CVID; CVID2; TNFRSF14B; FLJ39942; MGC39952; MGC133214; |
Gene ID | 23495 |
mRNA Refseq | NM_012452 |
Protein Refseq | NP_036584 |
MIM | 604907 |
UniProt ID | O14836 |
◆ Recombinant Proteins | ||
TNFRSF13B-4151H | Recombinant Human TNFRSF13B Protein (Met1-Ser165), C-His tagged | +Inquiry |
TNFRSF13B-506H | Active Recombinant Human TNFRSF13B protein, Fc-tagged | +Inquiry |
TNFRSF13B-0805H | Active Recombinant Human TNFRSF13B protein, His-tagged | +Inquiry |
TNFRSF13B-1648R | Recombinant Rhesus Monkey TNFRSF13B Protein | +Inquiry |
Tnfrsf13b-6545M | Active Recombinant Mouse Tnfrsf13b Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13B-1916HCL | Recombinant Human TNFRSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF13B Products
Required fields are marked with *
My Review for All TNFRSF13B Products
Required fields are marked with *
0
Inquiry Basket