Recombinant Human TNFRSF14 protein

Cat.No. : TNFRSF14-389H
Product Overview : Recombinant Human TNFRSF14 protein was expressed in Pichia. Pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : P.pastoris
Tag : Non
Protein Length : 396
Description : This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH7.4, with 3% Trehalose.
Bio-activity : Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta-mediated cytotoxicity using murine L929 cells.
Molecular Mass : Approximately 58 kDa, a glycosylated polypeptide chain containing 396 amino acids. But it migrates with an apparent molecular mass of 70 kDa in SDS-PAGE under reducing conditions.
AA Sequence : LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Less than 0.1 EU/µg of rHuHVEM-Fc/TNFRSF14 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNFRSF14
Official Symbol TNFRSF14
Synonyms TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2;
Gene ID 8764
mRNA Refseq NM_003820
Protein Refseq NP_003811
MIM 602746
UniProt ID Q92956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF14 Products

Required fields are marked with *

My Review for All TNFRSF14 Products

Required fields are marked with *

0
cart-icon
0
compare icon