Recombinant Human TNFRSF14 protein
Cat.No. : | TNFRSF14-389H |
Product Overview : | Recombinant Human TNFRSF14 protein was expressed in Pichia. Pastoris. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | P.pastoris |
Tag : | Non |
Protein Length : | 396 |
Description : | This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH7.4, with 3% Trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta-mediated cytotoxicity using murine L929 cells. |
Molecular Mass : | Approximately 58 kDa, a glycosylated polypeptide chain containing 396 amino acids. But it migrates with an apparent molecular mass of 70 kDa in SDS-PAGE under reducing conditions. |
AA Sequence : | LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Less than 0.1 EU/µg of rHuHVEM-Fc/TNFRSF14 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF14 |
Official Symbol | TNFRSF14 |
Synonyms | TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; |
Gene ID | 8764 |
mRNA Refseq | NM_003820 |
Protein Refseq | NP_003811 |
MIM | 602746 |
UniProt ID | Q92956 |
◆ Recombinant Proteins | ||
TNFRSF14-624H | Active Recombinant Human TNFRSF14, Fc-tagged, Biotinylated | +Inquiry |
TNFRSF14-625H | Active Recombinant Human TNFRSF14 Protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
Tnfrsf14-757M | Recombinant Mouse Tnfrsf14, Fc-His tagged | +Inquiry |
TNFRSF14-4682R | Recombinant Rhesus Macaque TNFRSF14 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF14-152H | Recombinant Human TNFRSF14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF14 Products
Required fields are marked with *
My Review for All TNFRSF14 Products
Required fields are marked with *
0
Inquiry Basket