Species : |
Human |
Source : |
P.pastoris |
Tag : |
Non |
Protein Length : |
396 |
Description : |
This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. |
Form : |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH7.4, with 3% Trehalose. |
Bio-activity : |
Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta-mediated cytotoxicity using murine L929 cells. |
Molecular Mass : |
Approximately 58 kDa, a glycosylated polypeptide chain containing 396 amino acids. But it migrates with an apparent molecular mass of 70 kDa in SDS-PAGE under reducing conditions. |
AA Sequence : |
LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : |
Less than 0.1 EU/µg of rHuHVEM-Fc/TNFRSF14 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analyses. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |