Recombinant Human TNFRSF14 Protein, Fc-tagged
| Cat.No. : | TNFRSF14-670H |
| Product Overview : | Recombinant human TNFRSF14 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 283 |
| Description : | This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. |
| Form : | Lyophilized |
| Molecular Mass : | 45.4 kDa |
| AA Sequence : | MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | TNFRSF14 tumor necrosis factor receptor superfamily, member 14 [ Homo sapiens (human) ] |
| Official Symbol | TNFRSF14 |
| Synonyms | TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; |
| Gene ID | 8764 |
| mRNA Refseq | NM_003820 |
| Protein Refseq | NP_003811 |
| MIM | 602746 |
| UniProt ID | Q92956 |
| ◆ Recombinant Proteins | ||
| TNFRSF14-555HAF555 | Recombinant Human TNFRSF14 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| Tnfrsf14-428MF | Recombinant Mouse Tnfrsf14 Protein, His-Fc-tagged, FITC conjugated | +Inquiry |
| TNFRSF14-75CAF647 | Recombinant Monkey TNFRSF14 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| TNFRSF14-555HB | Recombinant Human TNFRSF14 protein, His-tagged, Biotinylated | +Inquiry |
| Tnfrsf14-757MAF488 | Recombinant Mouse Tnfrsf14 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
| TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
| TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
| TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF14 Products
Required fields are marked with *
My Review for All TNFRSF14 Products
Required fields are marked with *
