Recombinant Human TNFRSF14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TNFRSF14-1991H |
Product Overview : | TNFRSF14 MS Standard C13 and N15-labeled recombinant protein (NP_003811) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | MEPPGDWGPPPWRSTPRTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TNFRSF14 TNF receptor superfamily member 14 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF14 |
Synonyms | TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; |
Gene ID | 8764 |
mRNA Refseq | NM_003820 |
Protein Refseq | NP_003811 |
MIM | 602746 |
UniProt ID | Q92956 |
◆ Recombinant Proteins | ||
TNFRSF14-152H | Recombinant Human TNFRSF14 Protein, His-tagged | +Inquiry |
Tnfrsf14-428M | Active Recombinant Mouse Tnfrsf14 protein(Met1-Gln206), His&hFc-tagged | +Inquiry |
TNFRSF14-75CAF488 | Recombinant Monkey TNFRSF14 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFRSF14-2171H | Active Recombinant Human TNFRSF14 protein, His-tagged | +Inquiry |
TNFRSF14-141T | Active Recombinant Human TNFRSF14 Protein (376 aa), Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-1133CCL | Recombinant Cynomolgus TNFRSF14 cell lysate | +Inquiry |
TNFRSF14-2420MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF14 Products
Required fields are marked with *
My Review for All TNFRSF14 Products
Required fields are marked with *