Recombinant Human TNFRSF17 Protein
Cat.No. : | TNFRSF17-5253H |
Product Overview : | Recombinant Human TNFRSF17 Protein (5-54 domain) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 5-54 a.a. |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. |
Molecular Mass : | Recombinant BCMA is a monomer protein consisting of 50 amino acid residue subunits, and migrates as an approximately 5 kDa protein under non-reducing and reducing conditions in SDS-PAGE. |
AA Sequence : | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL |
Endotoxin : | Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg). |
Purity : | >95%, as determined by SDS-PAGE and HPLC |
Storage : | The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this product can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Recombinant BCMA was lyophilized from a.2 μm filtered% acetonitrile, 1% TFA solutionpH.5. |
Reconstitution : | A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers. |
Gene Name | TNFRSF17 TNF receptor superfamily member 17 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF17 |
Synonyms | TNFRSF17; TNF receptor superfamily member 17; BCM; BCMA; CD269; TNFRSF13A; tumor necrosis factor receptor superfamily member 17; B cell maturation antigen; B-cell maturation factor; B-cell maturation protein |
Gene ID | 608 |
mRNA Refseq | NM_001192 |
Protein Refseq | NP_001183 |
MIM | 109545 |
UniProt ID | Q02223 |
◆ Recombinant Proteins | ||
TNFRSF17-121HAF488 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFRSF17-8829CP | Recombinant Rhesus TNFRSF17 protein, Fc-tagged, R-PE labeled | +Inquiry |
Tnfrsf17-2266M | Active Recombinant Mouse Tnfrsf17 protein, His&hFc-tagged | +Inquiry |
TNFRSF17-2070HAF488 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFRSF17-443H | Recombinant Human TNFRSF17 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *
0
Inquiry Basket