| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Protein Length : | 5-54 a.a. | 
                                
                                    | Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. | 
                                
                                    | Molecular Mass : | Recombinant BCMA is a monomer protein consisting of 50 amino acid residue subunits, and migrates as an approximately 5 kDa protein under non-reducing and reducing conditions in SDS-PAGE. | 
                                
                                    | AA Sequence : | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL | 
                                
                                    | Endotoxin : | Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg). | 
                                
                                    | Purity : | >95%, as determined by SDS-PAGE and HPLC | 
                                
                                    | Storage : | The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this product can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles. | 
                                
                                    | Storage Buffer : | Recombinant BCMA was lyophilized from a.2 μm filtered% acetonitrile, 1% TFA solutionpH.5. | 
                                
                                    | Reconstitution : | A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers. |