Recombinant Human TNFRSF17 Protein

Cat.No. : TNFRSF17-5253H
Product Overview : Recombinant Human TNFRSF17 Protein (5-54 domain) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 5-54 a.a.
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
Molecular Mass : Recombinant BCMA is a monomer protein consisting of 50 amino acid residue subunits, and migrates as an approximately 5 kDa protein under non-reducing and reducing conditions in SDS-PAGE.
AA Sequence : MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
Endotoxin : Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 1 ng/μg (1 EU/μg).
Purity : >95%, as determined by SDS-PAGE and HPLC
Storage : The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this product can be stored in working aliquots at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles.
Storage Buffer : Recombinant BCMA was lyophilized from a.2 μm filtered% acetonitrile, 1% TFA solutionpH.5.
Reconstitution : A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 1 mg/mL. This solution can then be diluted into other buffers.
Gene Name TNFRSF17 TNF receptor superfamily member 17 [ Homo sapiens (human) ]
Official Symbol TNFRSF17
Synonyms TNFRSF17; TNF receptor superfamily member 17; BCM; BCMA; CD269; TNFRSF13A; tumor necrosis factor receptor superfamily member 17; B cell maturation antigen; B-cell maturation factor; B-cell maturation protein
Gene ID 608
mRNA Refseq NM_001192
Protein Refseq NP_001183
MIM 109545
UniProt ID Q02223

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF17 Products

Required fields are marked with *

My Review for All TNFRSF17 Products

Required fields are marked with *

0
cart-icon