Recombinant Human TNFRSF17 Protein (50 aa)

Cat.No. : TNFRSF17-136T
Product Overview : Recombinant Human TNFRSF17 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 50
Description : BCMA, a member of the TNF receptor superfamily, binds to BAFF and APRIL. BCMA is expressed on mature B-cells and other B-cell lines and plays an important role in B cell development, function and regulation. BCMA also has the capability to activate NF-kappaB and JNK. The human BCMA gene codes for a 184 amino acid type I transmembrane protein, which contains a 54 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 107 amino acid extracellular domain.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Data Not Available.
Molecular Mass : Approximately 5.3 KDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
AA Sequence : AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Endotoxin : Less than 1 EU/mg of rHuIL-1α as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNFRSF17 tumor necrosis factor receptor superfamily, member 17 [ Homo sapiens ]
Official Symbol TNFRSF17
Synonyms TNFRSF17; tumor necrosis factor receptor superfamily, member 17; BCMA; tumor necrosis factor receptor superfamily member 17; BCM; CD269; B-cell maturation factor; B cell maturation antigen; B-cell maturation protein;
Gene ID 608
mRNA Refseq NM_001192
Protein Refseq NP_001183
MIM 109545
UniProt ID Q02223

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF17 Products

Required fields are marked with *

My Review for All TNFRSF17 Products

Required fields are marked with *

0
cart-icon
0
compare icon