Recombinant Human TNFRSF17 protein
Cat.No. : | TNFRSF17-26737TH |
Product Overview : | Recombinant Human TNFRSF17 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 50 |
Description : | B-Cell Maturation Antigen (BCMA), encoded by the TNFRSF17 gene in humans. It is a member of the TNF receptor superfamily and a type III membrane protein containing one extracellular cysteine rich domain. It is expressed on mature B-cells and other B-cell lines. BCMA can binds to TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, and has functions that promotes B-cell survival, plays a role in the regulation of humoral immunity, and activates NF-kappa-B and JNK BCMA. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % acetonitrile, 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit APRIL-mediated proliferation of anti-IgM stimulated murine B cells is no less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg in the presence of 100 ng/ml human APRIL. |
Molecular Mass : | Approximately 5.4 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids. |
AA Sequence : | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
Endotoxin : | Less than 1 EU/μg of rHuBCMA as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF17 |
Official Symbol | TNFRSF17 |
Synonyms | TNFRSF17; tumor necrosis factor receptor superfamily, member 17; BCMA; tumor necrosis factor receptor superfamily member 17; BCM; CD269; B-cell maturation factor; B cell maturation antigen; B-cell maturation protein; |
Gene ID | 608 |
mRNA Refseq | NM_001192 |
Protein Refseq | NP_001183 |
MIM | 109545 |
UniProt ID | Q02223 |
◆ Recombinant Proteins | ||
TNFRSF17-2348HF | Recombinant Human TNFRSF17 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
TNFRSF17-237H | Active Recombinant Human TNFRSF17 protein(Met1-Ala54), rFc-tagged | +Inquiry |
TNFRSF17-121HF | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, FITC conjugated | +Inquiry |
TNFRSF17-027CP | Recombinant Cynomolgus TNFRSF17 protein, hFc-tagged, R-PE labeled | +Inquiry |
Tnfrsf17-7442R | Recombinant Rat Tnfrsf17, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *
0
Inquiry Basket