Recombinant Human TNFRSF17 protein

Cat.No. : TNFRSF17-26737TH
Product Overview : Recombinant Human TNFRSF17 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 50
Description : B-Cell Maturation Antigen (BCMA), encoded by the TNFRSF17 gene in humans. It is a member of the TNF receptor superfamily and a type III membrane protein containing one extracellular cysteine rich domain. It is expressed on mature B-cells and other B-cell lines. BCMA can binds to TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, and has functions that promotes B-cell survival, plays a role in the regulation of humoral immunity, and activates NF-kappa-B and JNK BCMA.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % acetonitrile, 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit APRIL-mediated proliferation of anti-IgM stimulated murine B cells is no less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg in the presence of 100 ng/ml human APRIL.
Molecular Mass : Approximately 5.4 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
AA Sequence : AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Endotoxin : Less than 1 EU/μg of rHuBCMA as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNFRSF17
Official Symbol TNFRSF17
Synonyms TNFRSF17; tumor necrosis factor receptor superfamily, member 17; BCMA; tumor necrosis factor receptor superfamily member 17; BCM; CD269; B-cell maturation factor; B cell maturation antigen; B-cell maturation protein;
Gene ID 608
mRNA Refseq NM_001192
Protein Refseq NP_001183
MIM 109545
UniProt ID Q02223

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF17 Products

Required fields are marked with *

My Review for All TNFRSF17 Products

Required fields are marked with *

0
cart-icon
0
compare icon