| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
50 |
| Description : |
B-Cell Maturation Antigen (BCMA), encoded by the TNFRSF17 gene in humans. It is a member of the TNF receptor superfamily and a type III membrane protein containing one extracellular cysteine rich domain. It is expressed on mature B-cells and other B-cell lines. BCMA can binds to TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, and has functions that promotes B-cell survival, plays a role in the regulation of humoral immunity, and activates NF-kappa-B and JNK BCMA. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 30 % acetonitrile, 0.1 % TFA. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit APRIL-mediated proliferation of anti-IgM stimulated murine B cells is no less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg in the presence of 100 ng/ml human APRIL. |
| Molecular Mass : |
Approximately 5.4 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids. |
| AA Sequence : |
AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Endotoxin : |
Less than 1 EU/μg of rHuBCMA as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |