Recombinant Human TNFRSF1B protein
Cat.No. : | TNFRSF1B-5270H |
Product Overview : | Recombinant Human TNFRSF1B protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 184 |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. |
Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of > 5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-α. |
Molecular Mass : | Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 184 amino acids. |
AA Sequence : | MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
Endotoxin : | Less than 0.1 EU/µg of rHusTNF RII/TNFRSF1B as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF1B |
Official Symbol | TNFRSF1B |
Synonyms | TNFRSF1B; tumor necrosis factor receptor superfamily, member 1B; TNFR2; tumor necrosis factor receptor superfamily member 1B; CD120b; p75; TNF R II; TNF R75; TNFBR; TNFR80; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; soluble TNFR1B variant 1; tumor necrosis factor receptor 2; tumor necrosis factor beta receptor; tumor necrosis factor receptor type II; tumor necrosis factor binding protein 2; TBPII; TNFR1B; TNF-R75; p75TNFR; TNF-R-II; |
Gene ID | 7133 |
mRNA Refseq | NM_001066 |
Protein Refseq | NP_001057 |
MIM | 191191 |
UniProt ID | P20333 |
◆ Recombinant Proteins | ||
TNFRSF1B-2184C | Active Recombinant Cynomolgus/Rhesus TNFRSF1B protein, hFc-tagged | +Inquiry |
TNFRSF1B-164H | Active Recombinant Human TNFRSF1B | +Inquiry |
TNFRSF1B-6198R | Recombinant Rat TNFRSF1B Protein | +Inquiry |
TNFRSF1B-165H | Active Recombinant Human TNFRSF1B, Fc Chimera | +Inquiry |
TNFRSF1B-8828C | Recombinant Cynomolgus TNFRSF1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1B-1048CCL | Recombinant Cynomolgus TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-2192MCL | Recombinant Mouse TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-2632HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-851HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF1B Products
Required fields are marked with *
My Review for All TNFRSF1B Products
Required fields are marked with *
0
Inquiry Basket