Recombinant Human TNFRSF25 Protein (25-199 aa), His-tagged
| Cat.No. : | TNFRSF25-2154H |
| Product Overview : | Recombinant Human TNFRSF25 Protein (25-199 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-199 aa |
| Description : | Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 22.9 kDa |
| AA Sequence : | QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | TNFRSF25 tumor necrosis factor receptor superfamily, member 25 [ Homo sapiens ] |
| Official Symbol | TNFRSF25 |
| Synonyms | TNFRSF25; APO 3; DDR3; DR3; LARD; TR3; TRAMP; WSL 1; WSL LR; protein WSL-1; APO-3; WSL-1; WSL-LR; TNFRSF12; |
| Gene ID | 8718 |
| mRNA Refseq | NM_001039664 |
| Protein Refseq | NP_001034753 |
| MIM | 603366 |
| UniProt ID | Q93038 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF25 Products
Required fields are marked with *
My Review for All TNFRSF25 Products
Required fields are marked with *
