Recombinant Human TNFRSF25 Protein (25-199 aa), His-tagged
Cat.No. : | TNFRSF25-2154H |
Product Overview : | Recombinant Human TNFRSF25 Protein (25-199 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-199 aa |
Description : | Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.9 kDa |
AA Sequence : | QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TNFRSF25 tumor necrosis factor receptor superfamily, member 25 [ Homo sapiens ] |
Official Symbol | TNFRSF25 |
Synonyms | TNFRSF25; APO 3; DDR3; DR3; LARD; TR3; TRAMP; WSL 1; WSL LR; protein WSL-1; APO-3; WSL-1; WSL-LR; TNFRSF12; |
Gene ID | 8718 |
mRNA Refseq | NM_001039664 |
Protein Refseq | NP_001034753 |
MIM | 603366 |
UniProt ID | Q93038 |
◆ Recombinant Proteins | ||
TNFRSF25-1620M | Recombinant Mouse TNFRSF25 protein, His-tagged | +Inquiry |
TNFRSF25-1812R | Recombinant Rhesus Monkey TNFRSF25 Protein, hIgG4-tagged | +Inquiry |
TNFRSF25-1811R | Recombinant Rhesus Monkey TNFRSF25 Protein, hIgG1-tagged | +Inquiry |
Tnfrsf25-1067R | Recombinant Rat Tnfrsf25 protein, His & T7-tagged | +Inquiry |
TNFRSF25-300M | Active Recombinant Mouse TNFRSF25, MIgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF25-2154HCL | Recombinant Human TNFRSF25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF25 Products
Required fields are marked with *
My Review for All TNFRSF25 Products
Required fields are marked with *
0
Inquiry Basket