Recombinant Human TNFRSF4, Fc-tagged
| Cat.No. : | TNFRSF4-27215TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 26-207 of Human CD134 / OX40 , fused to the Fc region of Human IgG1 expressed in modified Human 293 cells, 55 and 65 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Fc |
| Protein Length : | 26-207 a.a. |
| Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. |
| Conjugation : | Fc |
| Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | Theoretical sequence:LHCVGDTYPSNDRCCHECRPGNGMVSRCS RSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSER KQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSP GDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPA TQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVGIPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK |
| Sequence Similarities : | Contains 4 TNFR-Cys repeats. |
| Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
| Official Symbol | TNFRSF4 |
| Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; |
| Gene ID | 7293 |
| mRNA Refseq | NM_003327 |
| Protein Refseq | NP_003318 |
| MIM | 600315 |
| Uniprot ID | P43489 |
| Chromosome Location | 1p36 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; |
| Function | binding; receptor activity; tumor necrosis factor-activated receptor activity; |
| ◆ Recombinant Proteins | ||
| TNFRSF4-687M | Recombinant Mouse TNFRSF4 Protein, Fc-tagged | +Inquiry |
| TNFRSF4-2221H | Recombinant Human TNFRSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tnfrsf4-7400MAF555 | Recombinant Mouse Tnfrsf4 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| TNFRSF4-871H | Recombinant Human TNFRSF4 Protein, DDK/His-tagged | +Inquiry |
| TNFRSF4-455H | Recombinant Human TNFRSF4, Fc Chimera | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
| TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
