Recombinant Human TNFRSF4, Fc-tagged
Cat.No. : | TNFRSF4-27215TH |
Product Overview : | Recombinant fragment corresponding to amino acids 26-207 of Human CD134 / OX40 , fused to the Fc region of Human IgG1 expressed in modified Human 293 cells, 55 and 65 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 26-207 a.a. |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. |
Conjugation : | Fc |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | Theoretical sequence:LHCVGDTYPSNDRCCHECRPGNGMVSRCS RSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSER KQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSP GDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPA TQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVGIPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK |
Sequence Similarities : | Contains 4 TNFR-Cys repeats. |
Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; |
Gene ID | 7293 |
mRNA Refseq | NM_003327 |
Protein Refseq | NP_003318 |
MIM | 600315 |
Uniprot ID | P43489 |
Chromosome Location | 1p36 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; |
Function | binding; receptor activity; tumor necrosis factor-activated receptor activity; |
◆ Recombinant Proteins | ||
TNFRSF4-683M | Recombinant Mouse TNFRSF4 Protein, Fc-tagged | +Inquiry |
TNFRSF4-1565R | Recombinant Rhesus Monkey TNFRSF4 Protein | +Inquiry |
TNFRSF4-19H | Active Recombinant Human TNFRSF4 Protein, Fc-tagged, Alexa Fluor® 488 conjugated | +Inquiry |
TNFRSF4-3247HAF555 | Recombinant Human TNFRSF4 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF4-548RAF647 | Recombinant Monkey TNFRSF4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *