Recombinant Human TNFRSF4 protein(141-210 aa), C-His-tagged

Cat.No. : TNFRSF4-2764H
Product Overview : Recombinant Human TNFRSF4 protein(P43489)(141-210 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 141-210 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP
Gene Name TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
Official Symbol TNFRSF4
Synonyms TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor;
Gene ID 7293
mRNA Refseq NM_003327
Protein Refseq NP_003318
MIM 600315
UniProt ID P43489

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF4 Products

Required fields are marked with *

My Review for All TNFRSF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon