Recombinant Human TNFRSF4 protein(141-210 aa), C-His-tagged
| Cat.No. : | TNFRSF4-2764H |
| Product Overview : | Recombinant Human TNFRSF4 protein(P43489)(141-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 141-210 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP |
| Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
| Official Symbol | TNFRSF4 |
| Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor; |
| Gene ID | 7293 |
| mRNA Refseq | NM_003327 |
| Protein Refseq | NP_003318 |
| MIM | 600315 |
| UniProt ID | P43489 |
| ◆ Recombinant Proteins | ||
| TNFRSF4-683M | Recombinant Mouse TNFRSF4 Protein, Fc-tagged | +Inquiry |
| TNFRSF4-339H | Recombinant Human TNFRSF4 protein, Fc-tagged | +Inquiry |
| TNFRSF4-687M | Recombinant Mouse TNFRSF4 Protein, Fc-tagged | +Inquiry |
| TNFRSF4-0595H | Recombinant Human TNFRSF4 protein, hFc-tagged | +Inquiry |
| Tnfrsf4-7400M | Recombinant Mouse Tnfrsf4 protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
| TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
