Recombinant Human TNFRSF8

Cat.No. : TNFRSF8-26927TH
Product Overview : Recombinant fragment of Human CD30 with proprietarytag; Predicted MWt 38.06 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 113 amino acids
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Molecular Weight : 38.060kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
Sequence Similarities : Contains 6 TNFR-Cys repeats.
Gene Name TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens ]
Official Symbol TNFRSF8
Synonyms TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1;
Gene ID 943
mRNA Refseq NM_001243
Protein Refseq NP_001234
MIM 153243
Uniprot ID P28908
Chromosome Location 1p36
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function binding; receptor activity; transmembrane signaling receptor activity; tumor necrosis factor-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF8 Products

Required fields are marked with *

My Review for All TNFRSF8 Products

Required fields are marked with *

0
cart-icon