Recombinant Human TNFRSF8
Cat.No. : | TNFRSF8-26927TH |
Product Overview : | Recombinant fragment of Human CD30 with proprietarytag; Predicted MWt 38.06 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 113 amino acids |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Molecular Weight : | 38.060kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA |
Sequence Similarities : | Contains 6 TNFR-Cys repeats. |
Gene Name | TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens ] |
Official Symbol | TNFRSF8 |
Synonyms | TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1; |
Gene ID | 943 |
mRNA Refseq | NM_001243 |
Protein Refseq | NP_001234 |
MIM | 153243 |
Uniprot ID | P28908 |
Chromosome Location | 1p36 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | binding; receptor activity; transmembrane signaling receptor activity; tumor necrosis factor-activated receptor activity; |
◆ Recombinant Proteins | ||
TNFRSF8-150H | Recombinant Human TNFRSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF8-641HAF488 | Recombinant Human TNFRSF8 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFRSF8-2027H | Recombinant Human TNFRSF8 Protein, MYC/DDK-tagged | +Inquiry |
TNFRSF8-908H | Recombinant Human TNFRSF8 protein, mFc-tagged | +Inquiry |
TNFRSF8-642HAF647 | Recombinant Human TNFRSF8 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF8-2097HCL | Recombinant Human TNFRSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF8 Products
Required fields are marked with *
My Review for All TNFRSF8 Products
Required fields are marked with *