Recombinant Human TNFRSF8 Protein, Fc-tagged
Cat.No. : | TNFRSF8-146H |
Product Overview : | Recombinant human TNFRSF8 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 595 |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported |
Form : | Lyophilized |
Molecular Mass : | 64.6 kDa |
AA Sequence : | MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF8 |
Synonyms | TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1; Ki-1 antigen; CD30L receptor; cytokine receptor CD30; lymphocyte activation antigen CD30; CD30; Ki-1; D1S166E; |
Gene ID | 943 |
mRNA Refseq | NM_001243 |
Protein Refseq | NP_001234 |
MIM | 153243 |
UniProt ID | P28908 |
◆ Recombinant Proteins | ||
TNFRSF8-08H | Recombinant Human TNFRSF8 Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
TNFRSF8-563H | Recombinant Human TNFRSF8, His tagged | +Inquiry |
CD30-3072H | Active Recombinant Human CD30 protein, His-tagged, FITC-Labeled | +Inquiry |
TNFRSF8-5858R | Recombinant Rat TNFRSF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF8-1691R | Recombinant Rhesus Monkey TNFRSF8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF8-2097HCL | Recombinant Human TNFRSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF8 Products
Required fields are marked with *
My Review for All TNFRSF8 Products
Required fields are marked with *
0
Inquiry Basket