Recombinant Human TNFRSF8 protein, His-tagged
Cat.No. : | TNFRSF8-2788H |
Product Overview : | Recombinant Human TNFRSF8 protein(19-246 aa), fused to His tag, was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-246 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens ] |
Official Symbol | TNFRSF8 |
Synonyms | TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1; Ki-1 antigen; CD30L receptor; cytokine receptor CD30; lymphocyte activation antigen CD30; CD30; Ki-1; D1S166E; |
Gene ID | 943 |
mRNA Refseq | NM_001243 |
Protein Refseq | NP_001234 |
MIM | 153243 |
UniProt ID | P28908 |
◆ Recombinant Proteins | ||
TNFRSF8-4659H | Active Recombinant Human TNFRSF8 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
TNFRSF8-180H | Recombinant Human TNFRSF8 Protein, His\Avi-tagged | +Inquiry |
TNFRSF8-1720R | Recombinant Rhesus Monkey TNFRSF8 Protein, hIgG1-tagged | +Inquiry |
TNFRSF8-1594HAF555 | Active Recombinant Human TNFRSF8 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD30-3072H | Active Recombinant Human CD30 protein, His-tagged, FITC-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF8-2097HCL | Recombinant Human TNFRSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF8 Products
Required fields are marked with *
My Review for All TNFRSF8 Products
Required fields are marked with *