Recombinant Human TNFSF11 Protein, His-tagged
| Cat.No. : | TNFSF11-001H |
| Product Overview : | Recombinant Human TNFSF11 Protein, His-tagged, expressed in Baculovirus-Insect Cells. |
| Availability | December 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 73-317 aa |
| Tag : | His |
| Molecular Mass : | 29 kDa |
| AA Sequence : | MQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDIDHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
| Gene Name | TNFSF11 TNF superfamily member 11 [ Homo sapiens (human) ] |
| Official Symbol | TNFSF11 |
| Synonyms | ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TNLG6B; TRANCE; hRANKL2;TNFSF11 |
| Gene ID | 8600 |
| MIM | 602642 |
| UniProt ID | O14788 |
| ◆ Recombinant Proteins | ||
| TNFSF11-6646H | Recombinant Human TNFSF11 Protein (Ile140-Asp317), N-His tagged | +Inquiry |
| TNFSF11-860M | Active Recombinant Mouse TNFSF11 Protein, Fc-tagged | +Inquiry |
| Tnfsf11-2138M | Recombinant Mouse Tnfsf11 Protein, His-tagged | +Inquiry |
| TNFSF11-424H | Recombinant Human TNFSF11, Fc tagged | +Inquiry |
| TNFSF11-459H | Recombinant Human TNFSF11 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
| TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
| TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
| TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF11 Products
Required fields are marked with *
My Review for All TNFSF11 Products
Required fields are marked with *
