Recombinant Human TNFSF11 Protein, His-tagged
Cat.No. : | TNFSF11-001H |
Product Overview : | Recombinant Human TNFSF11 Protein, His-tagged, expressed in Baculovirus-Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 73-317 aa |
Tag : | His |
Molecular Mass : | 29 kDa |
AA Sequence : | MQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDIDHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Gene Name | TNFSF11 TNF superfamily member 11 [ Homo sapiens (human) ] |
Official Symbol | TNFSF11 |
Synonyms | ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TNLG6B; TRANCE; hRANKL2;TNFSF11 |
Gene ID | 8600 |
MIM | 602642 |
UniProt ID | O14788 |
◆ Recombinant Proteins | ||
TNFSF11-2024M | Recombinant Mouse TNFSF11 Protein | +Inquiry |
TNFSF11-322HAF488 | Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Tnfsf11-6552M | Active Recombinant Mouse Tnfsf11 Protein, His-tagged | +Inquiry |
TNFSF11-424HF | Recombinant Human TNFSF11 Protein, Fc-tagged, FITC conjugated | +Inquiry |
TNFSF11-1679H | Recombinant Human TNFSF11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-1093HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
TNFSF11-1586MCL | Recombinant Mouse TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF11 Products
Required fields are marked with *
My Review for All TNFSF11 Products
Required fields are marked with *
0
Inquiry Basket