Recombinant Human TNFSF13 protein, Flag-His-tagged
Cat.No. : | TNFSF13-350H |
Product Overview : | Recombinant Human TNFSF13 protein(O75888)(112-250 aa), fused with N-terminal Flag and His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag&His |
Protein Length : | 112-250 aa |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 1M NaCl, pH8.3. |
Bio-activity : | Immobilized Human APRIL -Flag-His at 1μg/ml (100 μl/well) can bind Cynomolgus BCMA-Fc. The ED50 of Cynomolgus BCMA-Fc is 4.23 ng/ml. |
Molecular Mass : | 50 KDa |
AASequence : | DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
Endotoxin : | < 1 EU/µg as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt. |
Reconstitution : | It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ] |
Official Symbol | TNFSF13 |
Synonyms | TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; APRIL; CD256; a proliferation-inducing ligand; tumor necrosis factor-like protein ZTNF2; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; TALL2; ZTNF2; TALL-2; TRDL-1; FLJ57090; UNQ383/PRO715; |
Gene ID | 8741 |
mRNA Refseq | NM_001198622 |
Protein Refseq | NP_001185551 |
MIM | 604472 |
UniProt ID | O75888 |
◆ Recombinant Proteins | ||
Tnfsf13-401M | Recombinant Mouse Tnfsf13, FLAG-tagged | +Inquiry |
Tnfsf13-931M | Recombinant Mouse Tnfsf13, Fc tagged | +Inquiry |
TNFSF13-4873R | Recombinant Rhesus monkey TNFSF13 Protein, His-tagged | +Inquiry |
TNFSF13-754CB | Recombinant Cynomolgus TNFSF13 protein, His-Avi-Flag-tagged, Biotinylated | +Inquiry |
TNFSF13-7565H | Recombinant Human TNFSF13 protein, His-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF13-1346MCL | Recombinant Mouse TNFSF13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF13 Products
Required fields are marked with *
My Review for All TNFSF13 Products
Required fields are marked with *