Recombinant Human TNFSF13 protein, Flag-His-tagged

• Cat.No.: TNFSF13-350H
• Product Overview: Recombinant Human TNFSF13 protein(O75888)(112-250 aa), fused with N-terminal Flag and His tag, was expressed in Mammalian Cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag&His
• Protein Length: 112-250 aa
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 1M NaCl, pH8.3.
• Bio-activity: Immobilized Human APRIL -Flag-His at 1μg/ml (100 μl/well) can bind Cynomolgus BCMA-Fc. The ED50 of Cynomolgus BCMA-Fc is 4.23 ng/ml.
• Molecular Mass: 50 KDa
• AASequence: DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
• Endotoxin: < 1 EU/µg as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ]
• Official Symbol: TNFSF13
• Synonyms: TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; APRIL; CD256; a proliferation-inducing ligand; tumor necrosis factor-like protein ZTNF2; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; TALL2; ZTNF2; TALL-2; TRDL-1; FLJ57090; UNQ383/PRO715
• Gene ID: 8741
• mRNA Refseq: NM_001198622
• Protein Refseq: NP_001185551
• MIM: 604472
• UniProt ID: O75888