Recombinant Human TNFSF13 protein, Flag-His-tagged

Cat.No. : TNFSF13-350H
Product Overview : Recombinant Human TNFSF13 protein(O75888)(112-250 aa), fused with N-terminal Flag and His tag, was expressed in Mammalian Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag&His
Protein Length : 112-250 aa
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB, 1M NaCl, pH8.3.
Bio-activity : Immobilized Human APRIL -Flag-His at 1μg/ml (100 μl/well) can bind Cynomolgus BCMA-Fc. The ED50 of Cynomolgus BCMA-Fc is 4.23 ng/ml.
Molecular Mass : 50 KDa
AASequence : DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Endotoxin : < 1 EU/µg as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at ≤ -20°C, stable for one year after receipt.
Reconstitution : It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ]
Official Symbol TNFSF13
Synonyms TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand superfamily member 13; APRIL; CD256; a proliferation-inducing ligand; tumor necrosis factor-like protein ZTNF2; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; TALL2; ZTNF2; TALL-2; TRDL-1; FLJ57090; UNQ383/PRO715;
Gene ID 8741
mRNA Refseq NM_001198622
Protein Refseq NP_001185551
MIM 604472
UniProt ID O75888

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF13 Products

Required fields are marked with *

My Review for All TNFSF13 Products

Required fields are marked with *

0
cart-icon
0
compare icon