Recombinant Human TNFSF15 protein, His-tagged

Cat.No. : TNFSF15-4678H
Product Overview : Recombinant Human TNFSF15 protein(O95150-2)(1-192 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-192 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 23.9 kDa
AASequence : MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name TNFSF15 tumor necrosis factor (ligand) superfamily, member 15 [ Homo sapiens ]
Official Symbol TNFSF15
Synonyms TNFSF15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand superfamily member 15; MGC129934; MGC129935; TL1; TL1A; TNF ligand related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor 192A; VEGI; VEGI192A; TNF ligand-related molecule 1; vascular endothelial growth inhibitor-192A;
Gene ID 9966
mRNA Refseq NM_001204344
Protein Refseq NP_001191273
MIM 604052
UniProt ID O95150

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF15 Products

Required fields are marked with *

My Review for All TNFSF15 Products

Required fields are marked with *

0
cart-icon
0
compare icon