Recombinant Human TNFSF15 protein, His-tagged
Cat.No. : | TNFSF15-4678H |
Product Overview : | Recombinant Human TNFSF15 protein(O95150-2)(1-192 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-192 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 23.9 kDa |
AASequence : | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | TNFSF15 tumor necrosis factor (ligand) superfamily, member 15 [ Homo sapiens ] |
Official Symbol | TNFSF15 |
Synonyms | TNFSF15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand superfamily member 15; MGC129934; MGC129935; TL1; TL1A; TNF ligand related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor 192A; VEGI; VEGI192A; TNF ligand-related molecule 1; vascular endothelial growth inhibitor-192A; |
Gene ID | 9966 |
mRNA Refseq | NM_001204344 |
Protein Refseq | NP_001191273 |
MIM | 604052 |
UniProt ID | O95150 |
◆ Recombinant Proteins | ||
TNFSF15-4874R | Recombinant Rhesus monkey TNFSF15 Protein, His-tagged | +Inquiry |
TNFSF15-5860R | Recombinant Rat TNFSF15 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF15-0741M | Active Recombinant Mouse TNFSF15 protein, His-tagged | +Inquiry |
TNFSF15-1681M | Recombinant Mouse TNFSF15 protein, His-Avi-tagged | +Inquiry |
Tnfsf15-402M | Active Recombinant Mouse Tnfsf15, Met-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF15-1386RCL | Recombinant Rat TNFSF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF15 Products
Required fields are marked with *
My Review for All TNFSF15 Products
Required fields are marked with *