Recombinant Human TNFSF15 protein, His-tagged

• Cat.No.: TNFSF15-4678H
• Product Overview: Recombinant Human TNFSF15 protein(O95150-2)(1-192 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-192 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 23.9 kDa
• AASequence: MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: TNFSF15 tumor necrosis factor (ligand) superfamily, member 15 [ Homo sapiens ]
• Official Symbol: TNFSF15
• Synonyms: TNFSF15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand superfamily member 15; MGC129934; MGC129935; TL1; TL1A; TNF ligand related molecule 1; TNF superfamily ligand TL1A; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor 192A; VEGI; VEGI192A; TNF ligand-related molecule 1; vascular endothelial growth inhibitor-192A
• Gene ID: 9966
• mRNA Refseq: NM_001204344
• Protein Refseq: NP_001191273
• MIM: 604052
• UniProt ID: O95150