Recombinant Human TNFSF15 Protein, N-terminal His and AviTag™, Biotinylated
Cat.No. : | TNFSF15-17H |
Product Overview : | A DNA sequence encoding the human TL1A (Qln58-Leu251) with a polyhistidine tag and AviTag™ peptide at the N-terminus was expressed in E. coli and biotinylated at AviTag™. Based on the size-exclusion chromatography data, the purified protein elutes as a trimer. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | ~25 kDa (monomer) |
AA Sequence : | MHHHHHHGSGLNDIFEAQKIEWHEGGSQLRAQGEASVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Purity : | > 90% by Coomassie staining |
Notes : | This product is for laboratory research use only. |
Storage : | Storage is recommended at -80 centigrade for longer periods of time. |
Storage Buffer : | 20 mM Phosphate buffer, pH 7.4, 120 mM NaCl, 5 mM 2-mercaptoethanol, and 10% glycerol. |
Shipping : | Product requires shipping on ice packs. |
Gene Name | TNFSF15 TNF superfamily member 15 [ Homo sapiens (human) ] |
Official Symbol | TNFSF15 |
Synonyms | TNFSF15; TNF superfamily member 15; TL1; TL1A; VEGI; TNLG1B; VEGI192A; tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; TNF superfamily ligand TL1A; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand 1B; tumor necrosis factor superfamily member 15; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor-192A |
Gene ID | 9966 |
mRNA Refseq | NM_005118 |
Protein Refseq | NP_005109 |
MIM | 604052 |
UniProt ID | O95150 |
◆ Recombinant Proteins | ||
TNFSF15-27H | Recombinant Human Vascular Endothelial Growth Inhibitor | +Inquiry |
TNFSF15-17H | Recombinant Human TNFSF15 Protein, N-terminal His and AviTag™, Biotinylated | +Inquiry |
Tnfsf15-124M | Recombinant Mouse Tnfsf15 Protein, His-tagged | +Inquiry |
TNFSF15-4874R | Recombinant Rhesus monkey TNFSF15 Protein, His-tagged | +Inquiry |
TNFSF15-151H | Recombinant Human TNFSF15 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF15-1386RCL | Recombinant Rat TNFSF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF15 Products
Required fields are marked with *
My Review for All TNFSF15 Products
Required fields are marked with *
0
Inquiry Basket