Recombinant Human TNFSF4 Protein
Cat.No. : | TNFSF4-688H |
Product Overview : | Recombinant human TNFSF4 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 183 |
Description : | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
Molecular Mass : | 16.9 kDa |
AA Sequence : | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFSF4 |
Synonyms | TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L; OX40L; CD134 ligand; glycoprotein Gp34; OX40 antigen ligand; TAX transcriptionally-activated glycoprotein 1; tax-transcriptionally activated glycoprotein 1 (34kD); GP34; OX4OL; TXGP1; CD134L; OX-40L; |
Gene ID | 7292 |
mRNA Refseq | NM_003326 |
Protein Refseq | NP_003317 |
MIM | 603594 |
UniProt ID | P23510 |
◆ Recombinant Proteins | ||
TNFSF4-142H | Recombinant Human TNFSF4 Protein, His-tagged | +Inquiry |
TNFSF4-67CAF555 | Recombinant Monkey TNFSF4 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFSF4-491HAF647 | Recombinant Human TNFSF4 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFSF4-491H | Recombinant Human TNFSF4 protein, hFc-Flag-tagged | +Inquiry |
TNFSF4-5150H | Recombinant Human TNFSF4 protein, His-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *
0
Inquiry Basket