Recombinant Human TNFSF4 Protein, Fc-tagged
| Cat.No. : | TNFSF4-689H |
| Product Overview : | Recombinant human TNFSF4 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 183 |
| Description : | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. |
| Form : | Lyophilized |
| Molecular Mass : | 42.9 kDa |
| AA Sequence : | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ] |
| Official Symbol | TNFSF4 |
| Synonyms | TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L; OX40L; CD134 ligand; glycoprotein Gp34; OX40 antigen ligand; TAX transcriptionally-activated glycoprotein 1; tax-transcriptionally activated glycoprotein 1 (34kD); GP34; OX4OL; TXGP1; CD134L; OX-40L; |
| Gene ID | 7292 |
| mRNA Refseq | NM_003326 |
| Protein Refseq | NP_003317 |
| MIM | 603594 |
| UniProt ID | P23510 |
| ◆ Recombinant Proteins | ||
| TNFSF4-85C | Active Recombinant Cynomolgus TNFSF4, Fc-tagged | +Inquiry |
| TNFSF4-491HAF488 | Recombinant Human TNFSF4 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| TNFSF4-887M | Recombinant Mouse TNFSF4 Protein (Gln49-Leu198), RlgG Fc-tagged | +Inquiry |
| Tnfsf4-407M | Active Recombinant Mouse Tnfsf4, FLAG-tagged | +Inquiry |
| TNFSF4-67CAF555 | Recombinant Monkey TNFSF4 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *
