Recombinant Human TNFSF9 protein

• Cat.No.: TNFSF9-155H
• Product Overview: Recombinant human TNFSF8 cDNA (50 – 254 aa) protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 50-254 a.a.
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGACPWAVSG ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKE LVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLS AGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human TNFSF9 mediated T cell activation regulatory with this protein as either as soluble factor or as coating matrix.2. May be used for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens ]
• Official Symbol: TNFSF9
• Synonyms: TNFSF9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L
• Gene ID: 8744
• mRNA Refseq: NM_003811
• Protein Refseq: NP_003802
• MIM: 606182
• UniProt ID: P41273
• Chromosome Location: 19p13.3
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding