Recombinant Human TNFSF9 protein

Cat.No. : TNFSF9-155H
Product Overview : Recombinant human TNFSF8 cDNA (50 – 254 aa) protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 50-254 a.a.
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGACPWAVSG ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKE LVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLS AGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human TNFSF9 mediated T cell activation regulatory with this protein as either as soluble factor or as coating matrix.2. May be used for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens ]
Official Symbol TNFSF9
Synonyms TNFSF9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L;
Gene ID 8744
mRNA Refseq NM_003811
Protein Refseq NP_003802
MIM 606182
UniProt ID P41273
Chromosome Location 19p13.3
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function cytokine activity; receptor binding; tumor necrosis factor receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF9 Products

Required fields are marked with *

My Review for All TNFSF9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon