Recombinant Human TNFSF9 protein
Cat.No. : | TNFSF9-155H |
Product Overview : | Recombinant human TNFSF8 cDNA (50 – 254 aa) protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 50-254 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGACPWAVSG ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKE LVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLS AGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human TNFSF9 mediated T cell activation regulatory with this protein as either as soluble factor or as coating matrix.2. May be used for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | TNFSF9 tumor necrosis factor (ligand) superfamily, member 9 [ Homo sapiens ] |
Official Symbol | TNFSF9 |
Synonyms | TNFSF9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L; |
Gene ID | 8744 |
mRNA Refseq | NM_003811 |
Protein Refseq | NP_003802 |
MIM | 606182 |
UniProt ID | P41273 |
Chromosome Location | 19p13.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
◆ Recombinant Proteins | ||
TNFSF9-1511R | Recombinant Rhesus Monkey TNFSF9 Protein | +Inquiry |
Tnfsf9-7446RAF555 | Recombinant Rat Tnfsf9 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFSF9-3323H | Recombinant Human TNFSF9, GST-tagged | +Inquiry |
TNFSF9-5242H | Recombinant Human TNFSF9 protein, His-tagged | +Inquiry |
TNFSF9-232H | Recombinant Human TNFSF9 protein, His-tagged, low endotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF9-1445RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
TNFSF9-2810MCL | Recombinant Mouse TNFSF9 cell lysate | +Inquiry |
TNFSF9-1444RCL | Recombinant Rat TNFSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF9 Products
Required fields are marked with *
My Review for All TNFSF9 Products
Required fields are marked with *
0
Inquiry Basket