Recombinant Human TNKS2 protein, GST-tagged
Cat.No. : | TNKS2-3329H |
Product Overview : | Recombinant Human TNKS2(1068 a.a. - 1166 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1068 a.a. - 1166 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIY RGEQAYPEYLITYQIMRPEGMVDG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TNKS2 tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [ Homo sapiens ] |
Official Symbol | TNKS2 |
Synonyms | TNKS2; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2; tankyrase-2; PARP 5b; PARP 5c; PARP5B; PARP5C; pART6; TANK2; TNKL; TNKS-2; tankyrase 2; tankyrase II; tankyrase-like protein; tankyrase-related protein; poly [ADP-ribose] polymerase 5B; TRF1-interacting ankyrin-related ADP-ribose polymerase 2; PARP-5b; PARP-5c; |
Gene ID | 80351 |
mRNA Refseq | NM_025235 |
Protein Refseq | NP_079511 |
MIM | 607128 |
UniProt ID | Q9H2K2 |
Chromosome Location | 10q23.3 |
Function | NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
TNKS2-033H | Recombinant Human tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 Protein, His tagged | +Inquiry |
TNKS2-9492M | Recombinant Mouse TNKS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNKS2-5913C | Recombinant Chicken TNKS2 | +Inquiry |
TNKS2-4879R | Recombinant Rhesus monkey TNKS2 Protein, His-tagged | +Inquiry |
TNKS2-8199H | Recombinant Human TNKS2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNKS2 Products
Required fields are marked with *
My Review for All TNKS2 Products
Required fields are marked with *
0
Inquiry Basket