Recombinant Human TNKS2 protein, GST-tagged

• Cat.No.: TNKS2-3329H
• Product Overview: Recombinant Human TNKS2(1068 a.a. - 1166 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1068 a.a. - 1166 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: SNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIY RGEQAYPEYLITYQIMRPEGMVDG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TNKS2 tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [ Homo sapiens ]
• Official Symbol: TNKS2
• Synonyms: TNKS2; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2; tankyrase-2; PARP 5b; PARP 5c; PARP5B; PARP5C; pART6; TANK2; TNKL; TNKS-2; tankyrase 2; tankyrase II; tankyrase-like protein; tankyrase-related protein; poly [ADP-ribose] polymerase 5B; TRF1-interacting ankyrin-related ADP-ribose polymerase 2; PARP-5b; PARP-5c
• Gene ID: 80351
• mRNA Refseq: NM_025235
• Protein Refseq: NP_079511
• MIM: 607128
• UniProt ID: Q9H2K2
• Chromosome Location: 10q23.3
• Function: NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups