Recombinant Human TNMD Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TNMD-3952H
• Product Overview: TNMD MS Standard C13 and N15-labeled recombinant protein (NP_071427) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that is related to chondromodulin-I, which is a cartilage-specific glycoprotein that functions to stimulate chondrocyte growth and to inhibit tube formation of endothelial cells. This protein is also an angiogenesis inhibitor. Genetic variation in this gene is associated with a risk for type 2 diabetes, central obesity and serum levels of systemic immune mediators in a body size-dependent manner. This gene is also a candidate gene for age-related macular degeneration, though a direct link has yet to be demonstrated.
• Molecular Mass: 37 kDa
• AA Sequence: MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILTLTLIVLFWGSKHFWPEVPKKAYDMEHTFYSSGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TNMD tenomodulin [ Homo sapiens (human) ]
• Official Symbol: TNMD
• Synonyms: TNMD; tenomodulin; BRICD4; ChM1L; myodulin; TEM; tendin; hTeM; hChM1L; chondromodulin-IB; BRICHOS domain containing 4; chondromodulin-1-like protein; chondromodulin-I-like protein; CHM1L
• Gene ID: 64102
• mRNA Refseq: NM_022144
• Protein Refseq: NP_071427
• MIM: 300459
• UniProt ID: Q9H2S6