Recombinant Mouse TNMD Protein (51-317 aa), His-tagged
Cat.No. : | TNMD-2659M |
Product Overview : | Recombinant Mouse TNMD Protein (51-317 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 51-317 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.1 kDa |
AA Sequence : | KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Tnmd tenomodulin [ Mus musculus ] |
Official Symbol | TNMD |
Synonyms | TNMD; tenomodulin; mTeM; mChM1L; tendin; myodulin; TeM; ChM1L; 1110017I01Rik; |
Gene ID | 64103 |
mRNA Refseq | NM_022322 |
Protein Refseq | NP_071717 |
UniProt ID | Q9EP64 |
◆ Recombinant Proteins | ||
Tnmd-6564M | Recombinant Mouse Tnmd Protein, Myc/DDK-tagged | +Inquiry |
TNMD-2654M | Recombinant Mouse TNMD Protein (51-317 aa), His-tagged | +Inquiry |
TNMD-5863R | Recombinant Rat TNMD Protein, His (Fc)-Avi-tagged | +Inquiry |
TNMD-3952H | Recombinant Human TNMD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNMD-7108C | Recombinant Chicken TNMD | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNMD Products
Required fields are marked with *
My Review for All TNMD Products
Required fields are marked with *