Recombinant Human TNNC1 protein, His-tagged
| Cat.No. : | TNNC1-5643H |
| Product Overview : | Recombinant Human TNNC1 protein(P63316)(1-161aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 1-161aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
| Gene Name | TNNC1 troponin C type 1 (slow) [ Homo sapiens ] |
| Official Symbol | TNNC1 |
| Synonyms | TNNC1; troponin C type 1 (slow); TNNC, troponin C, slow; troponin C, slow skeletal and cardiac muscles; troponin C1, slow; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; TNC; TN-C; TNNC; CMD1Z; CMH13; |
| Gene ID | 7134 |
| mRNA Refseq | NM_003280 |
| Protein Refseq | NP_003271 |
| MIM | 191040 |
| UniProt ID | P63316 |
| ◆ Recombinant Proteins | ||
| TNNC1-9494M | Recombinant Mouse TNNC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNNC1-27224TH | Recombinant Human TNNC1 | +Inquiry |
| Tnnc1-6565M | Recombinant Mouse Tnnc1 Protein, Myc/DDK-tagged | +Inquiry |
| TNNC1-6119H | Recombinant Human TNNC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TNNC1-6896H | Recombinant Human Troponin C Type 1 (slow), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNNC1-885HCL | Recombinant Human TNNC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNC1 Products
Required fields are marked with *
My Review for All TNNC1 Products
Required fields are marked with *



