Recombinant Human TNNC1 protein, His-tagged

Cat.No. : TNNC1-5643H
Product Overview : Recombinant Human TNNC1 protein(P63316)(1-161aa), fused with C-terminal His tag, was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 1-161aa
Tag : C-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Gene Name TNNC1 troponin C type 1 (slow) [ Homo sapiens ]
Official Symbol TNNC1
Synonyms TNNC1; troponin C type 1 (slow); TNNC, troponin C, slow; troponin C, slow skeletal and cardiac muscles; troponin C1, slow; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; TNC; TN-C; TNNC; CMD1Z; CMH13;
Gene ID 7134
mRNA Refseq NM_003280
Protein Refseq NP_003271
MIM 191040
UniProt ID P63316

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNNC1 Products

Required fields are marked with *

My Review for All TNNC1 Products

Required fields are marked with *

0
cart-icon