Recombinant Human TNNC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TNNC2-2912H |
Product Overview : | TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. |
Molecular Mass : | 18.1 kDa |
AA Sequence : | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TNNC2 troponin C2, fast skeletal type [ Homo sapiens (human) ] |
Official Symbol | TNNC2 |
Synonyms | TNNC2; troponin C type 2 (fast); troponin C2, fast; troponin C, skeletal muscle; |
Gene ID | 7125 |
mRNA Refseq | NM_003279 |
Protein Refseq | NP_003270 |
MIM | 191039 |
UniProt ID | P02585 |
◆ Recombinant Proteins | ||
Tnnc2-6566M | Recombinant Mouse Tnnc2 Protein, Myc/DDK-tagged | +Inquiry |
TNNC2-7941H | Recombinant Human TNNC2 protein, His & GST-tagged | +Inquiry |
TNNC2-153H | Recombinant Human TNNC2 Protein, DDK-tagged | +Inquiry |
TNNC2-9106Z | Recombinant Zebrafish TNNC2 | +Inquiry |
TNNC2-3330H | Recombinant Human TNNC2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNC2-884HCL | Recombinant Human TNNC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNNC2 Products
Required fields are marked with *
My Review for All TNNC2 Products
Required fields are marked with *
0
Inquiry Basket