Recombinant Human TNNC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TNNC2-2912H
Product Overview : TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.
Molecular Mass : 18.1 kDa
AA Sequence : MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TNNC2 troponin C2, fast skeletal type [ Homo sapiens (human) ]
Official Symbol TNNC2
Synonyms TNNC2; troponin C type 2 (fast); troponin C2, fast; troponin C, skeletal muscle;
Gene ID 7125
mRNA Refseq NM_003279
Protein Refseq NP_003270
MIM 191039
UniProt ID P02585

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNNC2 Products

Required fields are marked with *

My Review for All TNNC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon