Recombinant Human TNPO2 protein, His-tagged
Cat.No. : | TNPO2-3338H |
Product Overview : | Recombinant Human TNPO2 protein(O14787)(Ala271-Asp360), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala271-Asp360 |
Form : | 0.15 M Phosphate buffered saline, pH 7.4. |
Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ALEACEFWLTLAEQPICKEVLASHLVQLIPILVNGMKYSEIDIILLKGDVEEDEAVPDSEQDIKPRFHKSRTVTLPHEAERPDGSEDAED |
Gene Name | TNPO2 transportin 2 [ Homo sapiens ] |
Official Symbol | TNPO2 |
Synonyms | TNPO2; transportin 2; transportin-2; FLJ12155; importin 3; IPO3; karyopherin beta 2b; KPNB2B; TRN2; karyopherin beta-2b; karyopherin beta 2b, transportin; transportin 2 (importin 3, karyopherin beta 2b) |
Gene ID | 30000 |
mRNA Refseq | NM_001136195 |
Protein Refseq | NP_001129667 |
MIM | 603002 |
UniProt ID | O14787 |
◆ Recombinant Proteins | ||
TNPO2-3338H | Recombinant Human TNPO2 protein, His-tagged | +Inquiry |
TNPO2-3337H | Recombinant Human TNPO2 protein, His-tagged | +Inquiry |
TNPO2-1201Z | Recombinant Zebrafish TNPO2 | +Inquiry |
TNPO2-06H | Recombinant Human TNPO2 Protein, 201-300, N-GST tagged | +Inquiry |
TNPO2-4697R | Recombinant Rhesus Macaque TNPO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNPO2 Products
Required fields are marked with *
My Review for All TNPO2 Products
Required fields are marked with *
0
Inquiry Basket