Recombinant Human TOMM40 protein, GST-tagged

Cat.No. : TOMM40-3607H
Product Overview : Recombinant Human TOMM40 protein(O96008)(1-361aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-361aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 64.9 kDa
AA Sequence : MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TOMM40 translocase of outer mitochondrial membrane 40 homolog (yeast) [ Homo sapiens ]
Official Symbol TOMM40
Synonyms TOMM40; translocase of outer mitochondrial membrane 40 homolog (yeast); mitochondrial import receptor subunit TOM40 homolog; C19orf1; D19S1177E; PER EC1; PEREC1; TOM40; p38.5; protein Haymaker; mitochondrial outer membrane protein; translocase of outer membrane 40 kDa subunit homolog; PER-EC1;
Gene ID 10452
mRNA Refseq NM_001128916
Protein Refseq NP_001122388
MIM 608061
UniProt ID O96008

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOMM40 Products

Required fields are marked with *

My Review for All TOMM40 Products

Required fields are marked with *

0
cart-icon
0
compare icon