Recombinant Human TOMM40 protein, GST-tagged
Cat.No. : | TOMM40-3607H |
Product Overview : | Recombinant Human TOMM40 protein(O96008)(1-361aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-361aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.9 kDa |
AA Sequence : | MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TOMM40 translocase of outer mitochondrial membrane 40 homolog (yeast) [ Homo sapiens ] |
Official Symbol | TOMM40 |
Synonyms | TOMM40; translocase of outer mitochondrial membrane 40 homolog (yeast); mitochondrial import receptor subunit TOM40 homolog; C19orf1; D19S1177E; PER EC1; PEREC1; TOM40; p38.5; protein Haymaker; mitochondrial outer membrane protein; translocase of outer membrane 40 kDa subunit homolog; PER-EC1; |
Gene ID | 10452 |
mRNA Refseq | NM_001128916 |
Protein Refseq | NP_001122388 |
MIM | 608061 |
UniProt ID | O96008 |
◆ Recombinant Proteins | ||
TOMM40-4708R | Recombinant Rhesus Macaque TOMM40 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOMM40-5541H | Recombinant Human TOMM40 Protein (Met1-Gly361), N-His tagged | +Inquiry |
TOMM40-3607H | Recombinant Human TOMM40 protein, GST-tagged | +Inquiry |
TOMM40-6219R | Recombinant Rat TOMM40 Protein | +Inquiry |
TOMM40-4894R | Recombinant Rhesus monkey TOMM40 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM40 Products
Required fields are marked with *
My Review for All TOMM40 Products
Required fields are marked with *