Recombinant Human TOPBP1 Protein, GST tagged

• Cat.No.: TOPBP1-33H
• Product Overview: Human TOPBP1 partial ORF ( NP_008958, 1327 a.a. - 1435 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1327-1435 aa
• Description: This gene encodes a binding protein which interacts with the C-terminal region of topoisomerase II beta. This interaction suggests a supportive role for this protein in the catalytic reactions of topoisomerase II beta through transient breakages of DNA strands.
• Molecular Weight: 37.73 kDa
• AA Sequence: LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Applications: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TOPBP1 DNA topoisomerase II binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: TOPBP1
• Synonyms: TOPBP1; topoisomerase (DNA) II binding protein 1; DNA topoisomerase 2-binding protein 1; KIAA0259; TOP2BP1; DNA topoisomerase II-binding protein 1; DNA topoisomerase II-beta-binding protein 1
• Gene ID: 11073
• mRNA Refseq: NM_007027
• Protein Refseq: NP_008958
• MIM: 607760
• UniProt ID: Q92547