Recombinant Human TOPBP1 Protein, GST tagged

Cat.No. : TOPBP1-33H
Product Overview : Human TOPBP1 partial ORF ( NP_008958, 1327 a.a. - 1435 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1327-1435 aa
Description : This gene encodes a binding protein which interacts with the C-terminal region of topoisomerase II beta. This interaction suggests a supportive role for this protein in the catalytic reactions of topoisomerase II beta through transient breakages of DNA strands.
Molecular Weight : 37.73 kDa
AA Sequence : LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Applications : Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TOPBP1 DNA topoisomerase II binding protein 1 [ Homo sapiens (human) ]
Official Symbol TOPBP1
Synonyms TOPBP1; topoisomerase (DNA) II binding protein 1; DNA topoisomerase 2-binding protein 1; KIAA0259; TOP2BP1; DNA topoisomerase II-binding protein 1; DNA topoisomerase II-beta-binding protein 1
Gene ID 11073
mRNA Refseq NM_007027
Protein Refseq NP_008958
MIM 607760
UniProt ID Q92547

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOPBP1 Products

Required fields are marked with *

My Review for All TOPBP1 Products

Required fields are marked with *

0
cart-icon