Recombinant Human TOPBP1 Protein, His-tagged
| Cat.No. : | TOPBP1-101H |
| Product Overview : | Recombinant Human TOPBP1 Protein(Q92547)(Thr1041-Ala1210), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Thr1041-Ala1210 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20°C to -80°C. |
| Molecular Mass : | 21 kDa |
| AA Sequence : | TNNKESAPSNGSGKNDSKGVLTQTLEMRENFQKQLQEIMSATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEA |
| Official Symbol | TOPBP1 |
| Synonyms | TOPBP1; topoisomerase (DNA) II binding protein 1; DNA topoisomerase 2-binding protein 1; KIAA0259; TOP2BP1; DNA topoisomerase II-binding protein 1; DNA topoisomerase II-beta-binding protein 1; |
| Gene ID | 11073 |
| mRNA Refseq | NM_007027 |
| Protein Refseq | NP_008958 |
| MIM | 607760 |
| UniProt ID | Q92547 |
| ◆ Recombinant Proteins | ||
| Topbp1-8250M | Recombinant Mouse Topbp1 protein, His & T7-tagged | +Inquiry |
| TOPBP1-4716R | Recombinant Rhesus Macaque TOPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TOPBP1-33H | Recombinant Human TOPBP1 Protein, GST tagged | +Inquiry |
| TOPBP1-9522M | Recombinant Mouse TOPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TOPBP1-17234M | Recombinant Mouse TOPBP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOPBP1 Products
Required fields are marked with *
My Review for All TOPBP1 Products
Required fields are marked with *
