Recombinant Human TOPBP1 Protein, His-tagged
Cat.No. : | TOPBP1-101H |
Product Overview : | Recombinant Human TOPBP1 Protein(Q92547)(Thr1041-Ala1210), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Thr1041-Ala1210 |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C to -80°C. |
Molecular Mass : | 21 kDa |
AA Sequence : | TNNKESAPSNGSGKNDSKGVLTQTLEMRENFQKQLQEIMSATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEA |
Official Symbol | TOPBP1 |
Synonyms | TOPBP1; topoisomerase (DNA) II binding protein 1; DNA topoisomerase 2-binding protein 1; KIAA0259; TOP2BP1; DNA topoisomerase II-binding protein 1; DNA topoisomerase II-beta-binding protein 1; |
Gene ID | 11073 |
mRNA Refseq | NM_007027 |
Protein Refseq | NP_008958 |
MIM | 607760 |
UniProt ID | Q92547 |
◆ Recombinant Proteins | ||
TOPBP1-7875Z | Recombinant Zebrafish TOPBP1 | +Inquiry |
TOPBP1-4902R | Recombinant Rhesus monkey TOPBP1 Protein, His-tagged | +Inquiry |
TOPBP1-4716R | Recombinant Rhesus Macaque TOPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOPBP1-100H | Recombinant Human DNA topoisomerase II binding protein 1 Protein, His tagged | +Inquiry |
TOPBP1-9522M | Recombinant Mouse TOPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOPBP1 Products
Required fields are marked with *
My Review for All TOPBP1 Products
Required fields are marked with *