Recombinant Human TOPBP1 Protein, His-tagged

Cat.No. : TOPBP1-101H
Product Overview : Recombinant Human TOPBP1 Protein(Q92547)(Thr1041-Ala1210), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Thr1041-Ala1210
Form : Phosphate buffered saline
Storage : Store at -20°C to -80°C.
Molecular Mass : 21 kDa
AA Sequence : TNNKESAPSNGSGKNDSKGVLTQTLEMRENFQKQLQEIMSATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTEPSQNEQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVCDPGNIRVTEA
Official Symbol TOPBP1
Synonyms TOPBP1; topoisomerase (DNA) II binding protein 1; DNA topoisomerase 2-binding protein 1; KIAA0259; TOP2BP1; DNA topoisomerase II-binding protein 1; DNA topoisomerase II-beta-binding protein 1;
Gene ID 11073
mRNA Refseq NM_007027
Protein Refseq NP_008958
MIM 607760
UniProt ID Q92547

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOPBP1 Products

Required fields are marked with *

My Review for All TOPBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon