Recombinant Human TOR1A
| Cat.No. : | TOR1A-29828TH |
| Product Overview : | Recombinant fragment with deletion at aa 303 , of Human Torsin A with N-Terminal proprietary tag.Mol Wt 62.41 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 332 amino acids |
| Description : | The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1. |
| Molecular Weight : | 62.410kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MKLGRAVLGLLLLAPSVVQAVEPISLGLALAGVLTGYIYP RLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKKIIL NAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIY EGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVS ACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQK AMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHAL SVSVFNNKNSGFWHSSLIHRNLIDYFVPFLPLEYKHLKMC IRVEMQSRGYEIDEDIVSRVAEMTFFPKEERVFSDKGCKT VFTKLDYYYDD |
| Gene Name | TOR1A torsin family 1, member A (torsin A) [ Homo sapiens ] |
| Official Symbol | TOR1A |
| Synonyms | TOR1A; torsin family 1, member A (torsin A); dystonia 1, torsion (autosomal dominant; torsin A) , DYT1; torsin-1A; DQ2; |
| Gene ID | 1861 |
| mRNA Refseq | NM_000113 |
| Protein Refseq | NP_000104 |
| MIM | 605204 |
| Uniprot ID | O14656 |
| Chromosome Location | 9q32-q34 |
| Pathway | Alpha-synuclein signaling, organism-specific biosystem; |
| Function | ATP binding; nucleotide binding; serine-type endopeptidase activity; unfolded protein binding; |
| ◆ Recombinant Proteins | ||
| TOR1A-786C | Recombinant Cynomolgus Monkey TOR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tor1a-543M | Recombinant Mouse Tor1a Protein, His-tagged | +Inquiry |
| Tor1a-6584M | Recombinant Mouse Tor1a Protein, Myc/DDK-tagged | +Inquiry |
| TOR1A-536H | Recombinant Human torsin family 1, member A (torsin A), His-tagged | +Inquiry |
| TOR1A-29827TH | Recombinant Human TOR1A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TOR1A-866HCL | Recombinant Human TOR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOR1A Products
Required fields are marked with *
My Review for All TOR1A Products
Required fields are marked with *
