Recombinant Human TOR3A protein, His-tagged
Cat.No. : | TOR3A-538H |
Product Overview : | Recombinant Human TOR3A protein(97-397 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 97-397 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | YLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLVQQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPEGHRAESPWTIFLFLSNLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TOR3A torsin family 3, member A [ Homo sapiens ] |
Official Symbol | TOR3A |
Synonyms | TOR3A; torsin family 3, member A; ADIR, ATP dependant interferon responsive; ADIR2; FLJ22345; |
Gene ID | 27432 |
MIM | 607555 |
UniProt ID | Q9H497 |
◆ Recombinant Proteins | ||
TOR3A-537H | Recombinant Human TOR3A Protein, His-tagged | +Inquiry |
TOR3A-4907R | Recombinant Rhesus monkey TOR3A Protein, His-tagged | +Inquiry |
TOR3A-4721R | Recombinant Rhesus Macaque TOR3A Protein, His (Fc)-Avi-tagged | +Inquiry |
TOR3A-5822H | Recombinant Human TOR3A Protein (Gly125-Lys375), N-His tagged | +Inquiry |
TOR3A-5886R | Recombinant Rat TOR3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOR3A-1811HCL | Recombinant Human TOR3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOR3A Products
Required fields are marked with *
My Review for All TOR3A Products
Required fields are marked with *
0
Inquiry Basket